YFHJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YFHJ - Uncharacterized protein YfhJ

UniProt:	O31578	Sequences: MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	89 (84)
Sequences:	103 (83)
Seq/√Len:	9.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_L	57_T	3.281	0.94
55_I	59_W	2.663	0.84
70_F	81_L	2.620	0.83
11_L	61_E	2.554	0.82
6_E	21_Y	2.427	0.78
72_S	81_L	2.413	0.78
37_A	49_E	2.329	0.75
5_I	49_E	2.137	0.68
30_L	75_N	2.113	0.67
23_Q	67_L	2.112	0.67
38_T	55_I	1.994	0.63
71_Q	81_L	1.882	0.58
58_Q	62_N	1.701	0.50
6_E	10_N	1.560	0.44
47_Q	51_M	1.546	0.43
63_Y	70_F	1.544	0.43
28_V	56_V	1.517	0.42
5_I	33_S	1.497	0.41
35_F	48_G	1.458	0.40
14_E	59_W	1.335	0.35
2_N	5_I	1.325	0.34
32_W	52_T	1.288	0.33
2_N	13_L	1.255	0.32
36_E	42_A	1.254	0.31
58_Q	70_F	1.237	0.31
23_Q	84_S	1.234	0.31
69_L	76_D	1.213	0.30
62_N	72_S	1.212	0.30
71_Q	78_N	1.183	0.29
54_K	58_Q	1.171	0.28
33_S	56_V	1.161	0.28
39_Y	69_L	1.123	0.27
5_I	25_K	1.121	0.27
32_W	46_Y	1.121	0.27
2_N	83_Q	1.120	0.27
2_N	82_N	1.106	0.26
10_N	72_S	1.097	0.26
36_E	58_Q	1.095	0.26
15_K	75_N	1.088	0.26
57_T	77_V	1.078	0.25
33_S	49_E	1.076	0.25
15_K	61_E	1.059	0.25
23_Q	45_A	1.048	0.24
69_L	75_N	1.016	0.23
36_E	81_L	0.987	0.22
13_L	22_I	0.975	0.22
3_M	7_K	0.970	0.22
47_Q	50_K	0.966	0.22
9_T	13_L	0.957	0.21
77_V	81_L	0.955	0.21
3_M	17_E	0.948	0.21
50_K	57_T	0.926	0.21
23_Q	39_Y	0.926	0.21
39_Y	51_M	0.923	0.20
3_M	6_E	0.918	0.20
52_T	55_I	0.898	0.20
75_N	81_L	0.881	0.19
36_E	63_Y	0.873	0.19
10_N	13_L	0.852	0.19
66_Q	84_S	0.835	0.18
80_Y	84_S	0.833	0.18
38_T	44_H	0.829	0.18
7_K	19_I	0.808	0.17
13_L	20_S	0.806	0.17
4_Y	65_G	0.806	0.17
56_V	67_L	0.804	0.17
14_E	69_L	0.789	0.17
3_M	20_S	0.784	0.17
7_K	84_S	0.781	0.17
41_K	84_S	0.778	0.17
54_K	70_F	0.774	0.17
74_R	77_V	0.773	0.17
26_T	54_K	0.771	0.17
17_E	44_H	0.762	0.16
37_A	60_I	0.762	0.16
44_H	50_K	0.752	0.16
26_T	63_Y	0.744	0.16
16_N	56_V	0.734	0.16
30_L	77_V	0.723	0.15
17_E	66_Q	0.719	0.15
54_K	57_T	0.715	0.15
19_I	65_G	0.704	0.15
32_W	38_T	0.699	0.15
38_T	52_T	0.693	0.15
28_V	50_K	0.680	0.14
31_L	41_K	0.670	0.14
31_L	35_F	0.659	0.14
69_L	77_V	0.653	0.14
22_I	73_S	0.646	0.14
52_T	59_W	0.644	0.14
71_Q	79_D	0.638	0.14
9_T	28_V	0.635	0.13
2_N	10_N	0.630	0.13
13_L	55_I	0.627	0.13
3_M	10_N	0.626	0.13
10_N	82_N	0.623	0.13
6_E	25_K	0.622	0.13
9_T	50_K	0.614	0.13
15_K	30_L	0.608	0.13
20_S	25_K	0.596	0.13
16_N	19_I	0.595	0.13
58_Q	81_L	0.594	0.13
62_N	83_Q	0.594	0.13
18_M	54_K	0.590	0.13
18_M	50_K	0.587	0.13
47_Q	55_I	0.582	0.12
1_M	68_H	0.577	0.12
18_M	62_N	0.573	0.12
56_V	72_S	0.571	0.12
11_L	51_M	0.569	0.12
53_E	59_W	0.567	0.12
57_T	75_N	0.562	0.12
20_S	78_N	0.560	0.12
9_T	18_M	0.552	0.12
44_H	80_Y	0.552	0.12
59_W	63_Y	0.547	0.12
29_E	41_K	0.534	0.12
44_H	59_W	0.531	0.12
22_I	66_Q	0.521	0.11
23_Q	55_I	0.518	0.11
35_F	38_T	0.516	0.11
9_T	25_K	0.515	0.11
20_S	53_E	0.510	0.11
42_A	63_Y	0.507	0.11
4_Y	51_M	0.504	0.11
4_Y	45_A	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qtlA	1	0.4719	15.8	0.935	Contact Map
3qe2A	1	0.4831	15.5	0.935	Contact Map
3qfsA	1	0.4719	13.8	0.937	Contact Map
1ddgA	1	0.4719	12.1	0.938	Contact Map
2bpoA	1	0.4719	12.1	0.939	Contact Map
4c4pB	1	0.3034	10.1	0.941	Contact Map
1f20A	1	0.4944	7.3	0.944	Contact Map
1uj8A	1	0.618	6.8	0.945	Contact Map
4lixA	1	0.8427	6.5	0.945	Contact Map
3tsoC	2	0.2921	6.3	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.