YFHC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YFHC - Putative NAD(P)H nitroreductase YfhC

UniProt:	O31571	Sequences: MPQTEQIHQHSVLRDIIRSRRSIRKFKQEPVPSAVILDMLETAKYAPNHRVTEPWRFIYVSSETGKANLINTFAAFSKKSKPDMTEEKLQNFKNTLGRVPGFLLVVFQEDENERARDDDFAATSSLIQNLQLLAWEKGIGMVWKSGKILYDKEVHQAFGLQDNERFAAIIQTGYPDEAPEVKKRTPIRDRFTEM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	194 (162)
Sequences:	13272 (9639)
Seq/√Len:	757.3

ECOLI - RUTE NFSA YDJA NFNB
BACSU - YFHC YODC MHQN NFRA1 YFKO YDGI NFRA2
HALSA - Q9HQZ4
SULSO - Q97VQ3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_P	35_V	3.344	1.00
38_D	137_K	3.182	1.00
33_S	61_S	2.569	1.00
33_S	37_L	2.391	1.00
57_F	126_L	2.387	1.00
58_I	106_V	2.380	1.00
39_M	134_A	2.257	1.00
19_S	135_W	2.100	1.00
106_V	164_E	2.085	1.00
35_V	137_K	2.084	1.00
140_G	175_P	2.082	1.00
70_I	97_G	1.969	1.00
131_Q	141_M	1.963	1.00
139_I	174_Y	1.920	1.00
41_E	44_K	1.888	1.00
57_F	103_L	1.817	1.00
42_T	133_L	1.797	1.00
15_D	19_S	1.785	1.00
127_I	168_A	1.767	1.00
68_N	157_A	1.736	1.00
67_A	97_G	1.721	1.00
35_V	139_I	1.696	1.00
27_K	176_D	1.679	1.00
43_A	130_L	1.619	1.00
25_K	176_D	1.607	1.00
155_H	166_F	1.589	1.00
127_I	170_I	1.564	1.00
63_E	67_A	1.562	1.00
29_E	174_Y	1.548	1.00
105_V	127_I	1.533	1.00
65_G	68_N	1.523	1.00
12_V	15_D	1.521	1.00
103_L	130_L	1.481	1.00
13_L	17_I	1.471	1.00
108_Q	163_N	1.459	1.00
14_R	38_D	1.428	1.00
39_M	130_L	1.410	1.00
131_Q	143_W	1.402	1.00
14_R	18_R	1.374	1.00
134_A	172_T	1.361	1.00
109_E	165_R	1.351	1.00
121_A	124_S	1.350	1.00
59_Y	101_G	1.331	1.00
72_T	153_E	1.323	1.00
30_P	61_S	1.321	1.00
18_R	45_Y	1.309	1.00
125_S	128_Q	1.305	1.00
131_Q	170_I	1.294	1.00
104_L	169_I	1.293	1.00
106_V	160_L	1.292	1.00
13_L	16_I	1.291	1.00
61_S	101_G	1.277	1.00
72_T	157_A	1.265	1.00
11_S	15_D	1.261	1.00
139_I	172_T	1.257	1.00
135_W	140_G	1.257	1.00
107_F	119_D	1.254	1.00
153_E	156_Q	1.245	1.00
35_V	174_Y	1.243	1.00
56_R	164_E	1.197	1.00
123_T	167_A	1.196	1.00
57_F	105_V	1.195	1.00
35_V	38_D	1.192	1.00
67_A	71_N	1.171	1.00
185_T	189_D	1.164	1.00
39_M	172_T	1.157	1.00
150_Y	153_E	1.155	1.00
105_V	130_L	1.135	1.00
102_F	169_I	1.126	1.00
105_V	123_T	1.123	1.00
62_S	65_G	1.112	1.00
36_I	101_G	1.112	1.00
104_L	166_F	1.107	1.00
65_G	157_A	1.096	1.00
143_W	168_A	1.094	1.00
69_L	154_V	1.091	1.00
37_L	188_R	1.083	1.00
63_E	66_K	1.075	1.00
46_A	129_N	1.063	1.00
18_R	41_E	1.056	1.00
11_S	136_E	1.053	1.00
133_L	137_K	1.051	1.00
22_S	142_V	1.048	1.00
103_L	172_T	1.048	1.00
39_M	139_I	1.044	1.00
153_E	157_A	1.037	1.00
14_R	42_T	1.033	1.00
110_D	163_N	1.031	1.00
134_A	141_M	1.029	1.00
60_V	104_L	1.023	1.00
42_T	137_K	1.020	1.00
15_D	18_R	1.018	1.00
118_D	145_S	1.017	1.00
141_M	170_I	1.008	1.00
56_R	108_Q	1.006	1.00
128_Q	132_L	0.994	1.00
37_L	41_E	0.991	1.00
64_T	67_A	0.986	1.00
37_L	187_I	0.980	1.00
107_F	123_T	0.968	1.00
141_M	172_T	0.961	1.00
129_N	132_L	0.957	1.00
26_F	171_Q	0.955	1.00
31_V	139_I	0.955	1.00
49_H	118_D	0.953	1.00
133_L	136_E	0.951	1.00
40_L	59_Y	0.950	1.00
44_K	190_R	0.946	1.00
59_Y	103_L	0.945	1.00
64_T	68_N	0.941	1.00
14_R	137_K	0.939	1.00
34_A	37_L	0.931	1.00
40_L	43_A	0.930	1.00
68_N	71_N	0.926	1.00
12_V	136_E	0.916	1.00
28_Q	98_R	0.899	1.00
13_L	136_E	0.897	1.00
105_V	170_I	0.894	1.00
144_K	171_Q	0.892	1.00
101_G	172_T	0.887	1.00
152_K	156_Q	0.879	1.00
71_N	75_A	0.872	1.00
127_I	143_W	0.869	1.00
13_L	132_L	0.868	1.00
142_V	171_Q	0.866	1.00
186_P	189_D	0.864	1.00
130_L	170_I	0.862	1.00
125_S	143_W	0.859	1.00
120_F	167_A	0.852	1.00
108_Q	164_E	0.834	1.00
121_A	145_S	0.833	1.00
32_P	174_Y	0.832	1.00
106_V	166_F	0.831	1.00
58_I	164_E	0.828	1.00
39_M	137_K	0.824	1.00
25_K	177_E	0.824	1.00
154_V	157_A	0.823	1.00
155_H	165_R	0.822	1.00
107_F	167_A	0.819	1.00
124_S	143_W	0.814	1.00
67_A	70_I	0.814	1.00
30_P	100_P	0.813	1.00
109_E	163_N	0.811	1.00
130_L	172_T	0.804	1.00
31_V	174_Y	0.788	1.00
17_I	129_N	0.786	1.00
161_Q	164_E	0.782	1.00
104_L	158_F	0.772	1.00
38_D	41_E	0.768	1.00
48_N	55_W	0.765	1.00
116_R	165_R	0.760	1.00
27_K	174_Y	0.756	1.00
38_D	42_T	0.748	1.00
94_N	98_R	0.736	1.00
14_R	136_E	0.736	1.00
17_I	132_L	0.734	1.00
152_K	155_H	0.729	1.00
102_F	171_Q	0.724	1.00
11_S	16_I	0.723	1.00
30_P	63_E	0.723	1.00
30_P	101_G	0.719	1.00
14_R	133_L	0.712	1.00
36_I	40_L	0.705	1.00
31_V	100_P	0.704	1.00
95_T	98_R	0.702	1.00
125_S	129_N	0.701	1.00
151_D	155_H	0.692	1.00
94_N	97_G	0.690	1.00
49_H	145_S	0.689	1.00
160_L	164_E	0.685	1.00
25_K	98_R	0.685	1.00
41_E	187_I	0.684	1.00
55_W	123_T	0.682	1.00
108_Q	111_E	0.682	1.00
179_P	182_K	0.680	1.00
31_V	35_V	0.679	1.00
151_D	166_F	0.673	1.00
73_F	96_L	0.668	1.00
16_I	132_L	0.668	1.00
29_E	32_P	0.666	1.00
36_I	172_T	0.661	1.00
60_V	65_G	0.656	1.00
56_R	106_V	0.656	1.00
73_F	76_F	0.650	1.00
43_A	57_F	0.649	1.00
121_A	125_S	0.647	1.00
120_F	124_S	0.643	1.00
48_N	53_E	0.639	1.00
68_N	72_T	0.638	1.00
16_I	136_E	0.637	1.00
66_K	102_F	0.624	1.00
99_V	102_F	0.618	1.00
112_N	115_A	0.614	1.00
31_V	34_A	0.607	1.00
73_F	169_I	0.607	1.00
93_K	97_G	0.604	1.00
151_D	165_R	0.604	1.00
49_H	122_A	0.593	1.00
122_A	145_S	0.593	1.00
96_L	171_Q	0.592	1.00
26_F	29_E	0.582	1.00
117_D	120_F	0.581	1.00
26_F	142_V	0.577	1.00
41_E	45_Y	0.576	1.00
44_K	187_I	0.574	1.00
39_M	43_A	0.570	1.00
58_I	158_F	0.569	1.00
13_L	133_L	0.566	1.00
66_K	70_I	0.565	1.00
36_I	103_L	0.563	1.00
40_L	103_L	0.562	1.00
24_R	95_T	0.562	1.00
155_H	162_D	0.559	1.00
149_L	169_I	0.556	1.00
18_R	38_D	0.556	1.00
34_A	38_D	0.554	1.00
23_I	175_P	0.553	1.00
24_R	142_V	0.548	1.00
128_Q	131_Q	0.547	1.00
40_L	190_R	0.544	1.00
55_W	126_L	0.541	1.00
185_T	190_R	0.538	1.00
38_D	133_L	0.538	1.00
20_R	47_P	0.538	1.00
66_K	101_G	0.536	1.00
27_K	100_P	0.530	1.00
96_L	102_F	0.530	1.00
120_F	165_R	0.529	1.00
27_K	177_E	0.528	1.00
43_A	126_L	0.527	1.00
116_R	120_F	0.527	1.00
60_V	69_L	0.524	1.00
65_G	69_L	0.523	1.00
23_I	140_G	0.521	1.00
36_I	59_Y	0.521	1.00
69_L	102_F	0.517	1.00
35_V	39_M	0.513	1.00
160_L	166_F	0.513	1.00
70_I	75_A	0.506	1.00
60_V	158_F	0.506	1.00
28_Q	63_E	0.504	1.00
47_P	128_Q	0.502	1.00
65_G	158_F	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3eofA	2	0.8557	100	0.185	Contact Map
1noxA	2	0.8608	100	0.185	Contact Map
4qlxA	2	0.9124	100	0.186	Contact Map
1f5vA	2	0.866	100	0.187	Contact Map
3of4A	3	0.8505	100	0.188	Contact Map
1icrA	2	0.8711	100	0.189	Contact Map
1zchA	2	0.866	100	0.189	Contact Map
1bkjA	2	0.8608	100	0.19	Contact Map
3n2sA	2	0.8608	100	0.19	Contact Map
3bemA	2	0.8763	100	0.192	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.