SSPH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SSPH - Small, acid-soluble spore protein H

UniProt:	O31552	Sequences: MNIQRAKEIVESPDMKKVTYNGVPIYIQHVNEETGTARIYPLDEPQEEHEVQLNSLKED	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	59 (58)
Sequences:	147 (112)
Seq/√Len:	14.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_Q	40_Y	4.261	1.00
38_R	48_E	3.240	0.99
28_Q	48_E	2.888	0.97
28_Q	38_R	2.559	0.94
26_Y	42_L	2.533	0.94
10_V	16_K	2.512	0.93
15_M	26_Y	2.089	0.85
20_Y	39_I	2.069	0.84
13_P	42_L	1.806	0.75
40_Y	48_E	1.804	0.75
31_N	46_Q	1.761	0.73
2_N	48_E	1.469	0.58
31_N	35_G	1.314	0.50
10_V	14_D	1.205	0.44
11_E	14_D	1.195	0.43
15_M	42_L	1.181	0.43
7_K	31_N	1.171	0.42
22_G	31_N	1.144	0.41
35_G	53_L	1.081	0.37
3_I	35_G	1.067	0.37
36_T	50_E	1.059	0.36
31_N	38_R	1.022	0.34
8_E	42_L	0.992	0.33
44_E	47_E	0.983	0.32
5_R	27_I	0.979	0.32
11_E	50_E	0.963	0.31
41_P	46_Q	0.925	0.30
13_P	26_Y	0.924	0.30
29_H	38_R	0.922	0.29
12_S	49_H	0.919	0.29
19_T	54_N	0.903	0.29
4_Q	16_K	0.891	0.28
3_I	32_E	0.885	0.28
38_R	50_E	0.856	0.27
8_E	15_M	0.855	0.26
7_K	38_R	0.855	0.26
11_E	40_Y	0.844	0.26
11_E	24_P	0.838	0.26
47_E	54_N	0.829	0.25
39_I	46_Q	0.826	0.25
27_I	39_I	0.825	0.25
33_E	36_T	0.816	0.25
42_L	45_P	0.800	0.24
14_D	25_I	0.797	0.24
4_Q	26_Y	0.781	0.23
2_N	38_R	0.773	0.23
37_A	53_L	0.768	0.23
17_K	22_G	0.764	0.23
7_K	32_E	0.757	0.22
26_Y	41_P	0.756	0.22
22_G	44_E	0.750	0.22
4_Q	42_L	0.742	0.22
41_P	49_H	0.725	0.21
2_N	28_Q	0.696	0.20
31_N	55_S	0.694	0.20
41_P	48_E	0.691	0.20
39_I	55_S	0.688	0.20
7_K	53_L	0.673	0.19
8_E	11_E	0.664	0.19
3_I	47_E	0.661	0.19
21_N	47_E	0.659	0.19
31_N	36_T	0.657	0.19
25_I	36_T	0.654	0.19
12_S	16_K	0.653	0.19
47_E	52_Q	0.620	0.18
9_I	19_T	0.609	0.17
39_I	52_Q	0.609	0.17
33_E	43_D	0.609	0.17
33_E	53_L	0.608	0.17
17_K	34_T	0.600	0.17
40_Y	54_N	0.598	0.17
33_E	57_K	0.590	0.17
21_N	29_H	0.587	0.17
49_H	52_Q	0.578	0.16
19_T	34_T	0.574	0.16
32_E	35_G	0.572	0.16
23_V	44_E	0.563	0.16
21_N	35_G	0.549	0.15
19_T	44_E	0.537	0.15
22_G	50_E	0.537	0.15
50_E	57_K	0.529	0.15
4_Q	35_G	0.515	0.14
15_M	23_V	0.515	0.14
7_K	43_D	0.515	0.14
17_K	49_H	0.512	0.14
8_E	24_P	0.509	0.14
13_P	43_D	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pmhX	1	0.6102	18	0.899	Contact Map
4nl7A	1	0.9831	10.3	0.91	Contact Map
1ixhA	1	0.4237	8.4	0.913	Contact Map
2jesA	5	0	8.3	0.913	Contact Map
4aw7A	1	0.8814	6.8	0.917	Contact Map
2mlwA	1	0.7119	6.2	0.918	Contact Map
4anjA	1	0.8814	5.9	0.919	Contact Map
2w7aA	1	0.5085	5.8	0.919	Contact Map
2v26A	1	0.8475	5.8	0.92	Contact Map
4i43B	1	0.8983	5.1	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.