YEZB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YEZB - Uncharacterized protein YezB

UniProt:	O31537	Sequences: MLETVPVRCVERKITSLVVDLSGVPIVDTMVAQQLYNLSKTLFLLGVKAVFSGIRPDVAQTSIQLGLDFSEYETYGTLKQALENMGVRCIVEELEENK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	98 (85)
Sequences:	793 (522)
Seq/√Len:	56.6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_S	81_A	4.302	1.00
9_C	42_L	4.289	1.00
5_V	17_L	2.868	1.00
29_T	61_T	2.623	1.00
33_Q	37_N	2.504	1.00
8_R	11_E	2.397	1.00
6_P	41_T	2.344	1.00
22_S	47_V	2.285	1.00
29_T	65_L	2.246	1.00
16_S	85_M	2.182	1.00
4_T	8_R	1.845	0.99
50_V	73_E	1.806	0.99
60_Q	64_Q	1.770	0.99
2_L	41_T	1.638	0.99
9_C	14_I	1.608	0.99
62_S	69_F	1.606	0.99
4_T	58_V	1.507	0.98
21_L	58_V	1.375	0.96
26_I	61_T	1.356	0.96
21_L	27_V	1.353	0.96
75_Y	84_N	1.349	0.96
19_V	54_I	1.313	0.95
82_L	87_V	1.301	0.95
17_L	30_M	1.298	0.95
9_C	47_V	1.212	0.92
38_L	42_L	1.202	0.92
8_R	12_R	1.143	0.90
17_L	47_V	1.131	0.89
39_S	72_Y	1.129	0.89
76_G	80_Q	1.099	0.88
61_T	65_L	1.079	0.87
40_K	43_F	1.074	0.87
34_Q	49_A	1.067	0.86
73_E	84_N	1.054	0.86
4_T	83_E	1.040	0.85
16_S	50_V	1.039	0.85
26_I	29_T	1.035	0.85
77_T	80_Q	1.007	0.83
18_V	81_A	1.002	0.83
25_P	39_S	0.992	0.82
42_L	49_A	0.977	0.81
2_L	34_Q	0.970	0.81
8_R	82_L	0.948	0.79
18_V	52_S	0.939	0.78
48_K	73_E	0.926	0.77
9_C	18_V	0.922	0.77
52_S	76_G	0.910	0.76
34_Q	37_N	0.909	0.76
27_V	31_V	0.907	0.76
16_S	49_A	0.884	0.74
24_V	31_V	0.874	0.73
36_Y	39_S	0.873	0.73
54_I	74_T	0.866	0.73
5_V	38_L	0.866	0.73
11_E	18_V	0.858	0.72
9_C	45_L	0.845	0.71
7_V	10_V	0.844	0.71
10_V	13_K	0.826	0.69
42_L	47_V	0.826	0.69
10_V	49_A	0.821	0.68
6_P	62_S	0.810	0.67
27_V	32_A	0.805	0.67
19_V	48_K	0.795	0.66
5_V	49_A	0.783	0.65
2_L	17_L	0.780	0.64
16_S	84_N	0.774	0.64
26_I	52_S	0.767	0.63
19_V	69_F	0.758	0.62
14_I	22_S	0.757	0.62
31_V	59_A	0.757	0.62
68_D	71_E	0.753	0.62
43_F	48_K	0.751	0.62
50_V	75_Y	0.747	0.61
21_L	78_L	0.747	0.61
33_Q	40_K	0.736	0.60
25_P	82_L	0.734	0.60
41_T	77_T	0.733	0.60
50_V	84_N	0.731	0.59
5_V	14_I	0.731	0.59
81_A	85_M	0.720	0.58
63_I	72_Y	0.696	0.56
15_T	63_I	0.693	0.55
36_Y	48_K	0.691	0.55
12_R	58_V	0.687	0.55
9_C	22_S	0.682	0.54
27_V	58_V	0.680	0.54
21_L	31_V	0.675	0.53
29_T	60_Q	0.670	0.53
52_S	79_K	0.663	0.52
19_V	50_V	0.660	0.52
34_Q	39_S	0.658	0.52
39_S	82_L	0.657	0.52
22_S	42_L	0.650	0.51
12_R	79_K	0.635	0.49
76_G	85_M	0.635	0.49
34_Q	58_V	0.626	0.48
43_F	71_E	0.617	0.47
26_I	35_L	0.616	0.47
17_L	22_S	0.610	0.46
71_E	83_E	0.607	0.46
48_K	80_Q	0.597	0.45
16_S	76_G	0.593	0.45
21_L	87_V	0.592	0.44
8_R	38_L	0.590	0.44
30_M	55_R	0.590	0.44
45_L	69_F	0.583	0.43
17_L	38_L	0.577	0.43
11_E	62_S	0.575	0.43
5_V	50_V	0.574	0.43
32_A	39_S	0.572	0.42
9_C	27_V	0.568	0.42
45_L	74_T	0.562	0.41
4_T	10_V	0.560	0.41
52_S	64_Q	0.558	0.41
13_K	77_T	0.551	0.40
43_F	59_A	0.551	0.40
30_M	36_Y	0.549	0.40
32_A	61_T	0.544	0.39
40_K	64_Q	0.544	0.39
66_G	76_G	0.535	0.38
81_A	84_N	0.534	0.38
8_R	77_T	0.528	0.38
3_E	78_L	0.512	0.36
45_L	87_V	0.509	0.36
63_I	67_L	0.507	0.36
21_L	62_S	0.506	0.35
28_D	32_A	0.501	0.35
6_P	51_F	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zxnA	1	0.9286	99	0.646	Contact Map
3ny7A	1	0.8367	98.5	0.704	Contact Map
4xs5A	1	0.9592	98.5	0.705	Contact Map
2klnA	1	0.898	98.4	0.715	Contact Map
4qtpA	2	0.8673	98.4	0.716	Contact Map
3t6oA	5	0.8776	98.4	0.716	Contact Map
2ka5A	1	0.8878	98.4	0.717	Contact Map
3lloA	1	0.8367	98.3	0.721	Contact Map
1th8B	1	0.8878	98.3	0.721	Contact Map
4dghA	4	0.9184	98.3	0.722	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.