YETH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YETH - Uncharacterized protein YetH

UniProt:	O31535	Sequences: MIKQIGTVAVYVEDQQKAKQFWTEKVGFDIAADHPMGPEASWLEVAPKGAETRLVIYPKAMMKGSEQMKASIVFECEDIFGTYEKMKTNGVEFLGEPNQMEWGTFVQFKDEDGNVFLLKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	120 (114)
Sequences:	2824 (1657)
Seq/√Len:	155.2

ECOLI - YAER LGUL
BACSU - YETH YURT YWBC YWKD YRAH FOSB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_Q	24_E	4.892	1.00
84_E	88_T	3.864	1.00
92_E	109_K	3.531	1.00
80_F	104_T	3.396	1.00
85_K	89_N	3.150	1.00
33_D	41_S	2.693	1.00
78_D	81_G	2.662	1.00
31_A	46_A	2.540	1.00
76_C	82_T	2.389	1.00
19_K	30_I	2.320	1.00
94_L	115_V	2.291	1.00
87_K	96_E	2.117	1.00
99_Q	104_T	2.080	1.00
80_F	99_Q	2.062	1.00
83_Y	87_K	2.054	1.00
86_M	91_V	2.044	1.00
6_G	75_E	1.916	1.00
13_E	17_K	1.880	1.00
80_F	84_E	1.833	1.00
14_D	17_K	1.805	1.00
13_E	112_D	1.752	1.00
16_Q	20_Q	1.526	1.00
95_G	98_N	1.524	1.00
35_P	39_E	1.512	1.00
106_V	118_L	1.482	1.00
81_G	85_K	1.451	1.00
84_E	87_K	1.440	1.00
82_T	85_K	1.394	1.00
107_Q	117_L	1.345	1.00
86_M	93_F	1.317	1.00
93_F	108_F	1.302	1.00
15_Q	43_L	1.245	1.00
23_T	30_I	1.225	1.00
13_E	111_E	1.201	1.00
25_K	89_N	1.157	1.00
29_D	49_G	1.135	1.00
80_F	83_Y	1.134	1.00
79_I	104_T	1.132	1.00
20_Q	25_K	1.123	1.00
29_D	48_K	1.123	1.00
16_Q	41_S	1.107	0.99
83_Y	96_E	1.105	0.99
7_T	73_V	1.100	0.99
72_I	116_F	1.067	0.99
93_F	106_V	1.038	0.99
23_T	45_V	1.036	0.99
4_Q	51_E	1.029	0.99
82_T	118_L	1.016	0.99
62_M	65_S	1.014	0.99
22_W	26_V	1.004	0.99
17_K	111_E	0.998	0.99
19_K	43_L	0.991	0.99
4_Q	75_E	0.967	0.99
36_M	39_E	0.963	0.99
79_I	105_F	0.959	0.99
31_A	53_R	0.955	0.98
7_T	55_V	0.941	0.98
83_Y	106_V	0.935	0.98
57_Y	61_M	0.933	0.98
94_L	109_K	0.933	0.98
6_G	73_V	0.922	0.98
29_D	46_A	0.920	0.98
20_Q	23_T	0.902	0.98
64_G	67_Q	0.885	0.98
95_G	105_F	0.885	0.98
7_T	44_E	0.883	0.97
16_Q	19_K	0.873	0.97
74_F	116_F	0.862	0.97
95_G	106_V	0.858	0.97
26_V	54_L	0.852	0.97
12_V	15_Q	0.844	0.97
109_K	115_V	0.835	0.96
100_M	105_F	0.834	0.96
18_A	112_D	0.827	0.96
63_K	66_E	0.812	0.96
100_M	103_G	0.806	0.96
91_V	108_F	0.801	0.96
70_A	73_V	0.792	0.95
36_M	40_A	0.790	0.95
12_V	18_A	0.790	0.95
25_K	91_V	0.775	0.95
57_Y	71_S	0.764	0.94
19_K	23_T	0.760	0.94
28_F	47_P	0.754	0.94
67_Q	71_S	0.751	0.94
5_I	74_F	0.743	0.93
59_K	64_G	0.742	0.93
54_L	72_I	0.733	0.93
8_V	71_S	0.733	0.93
57_Y	62_M	0.731	0.93
83_Y	97_P	0.724	0.92
105_F	117_L	0.723	0.92
85_K	91_V	0.723	0.92
86_M	108_F	0.719	0.92
26_V	45_V	0.716	0.92
41_S	44_E	0.715	0.92
25_K	86_M	0.712	0.92
21_F	111_E	0.708	0.92
7_T	75_E	0.704	0.91
81_G	84_E	0.704	0.91
22_W	116_F	0.699	0.91
7_T	53_R	0.695	0.91
73_V	102_W	0.693	0.91
17_K	112_D	0.681	0.90
62_M	66_E	0.681	0.90
97_P	106_V	0.672	0.89
10_V	69_K	0.669	0.89
96_E	106_V	0.666	0.89
82_T	86_M	0.665	0.89
24_E	89_N	0.661	0.89
87_K	92_E	0.658	0.88
15_Q	32_A	0.647	0.88
10_V	22_W	0.645	0.87
22_W	112_D	0.643	0.87
14_D	90_G	0.638	0.87
7_T	71_S	0.638	0.87
70_A	117_L	0.637	0.87
5_I	86_M	0.631	0.86
9_A	68_M	0.626	0.86
102_W	105_F	0.625	0.86
92_E	113_G	0.622	0.85
74_F	78_D	0.614	0.85
85_K	88_T	0.613	0.85
110_D	114_N	0.612	0.85
49_G	53_R	0.608	0.84
8_V	73_V	0.606	0.84
11_Y	59_K	0.601	0.83
7_T	101_E	0.597	0.83
9_A	70_A	0.593	0.83
44_E	53_R	0.585	0.82
61_M	66_E	0.581	0.81
48_K	51_E	0.577	0.81
40_A	43_L	0.573	0.81
96_E	99_Q	0.570	0.80
46_A	53_R	0.569	0.80
15_Q	42_W	0.569	0.80
34_H	44_E	0.567	0.80
55_V	58_P	0.565	0.80
30_I	33_D	0.563	0.79
83_Y	93_F	0.561	0.79
47_P	74_F	0.560	0.79
42_W	102_W	0.559	0.79
31_A	44_E	0.558	0.79
19_K	41_S	0.557	0.79
15_Q	56_I	0.552	0.78
11_Y	67_Q	0.549	0.78
59_K	65_S	0.546	0.77
11_Y	62_M	0.540	0.76
58_P	63_K	0.539	0.76
80_F	93_F	0.535	0.76
13_E	65_S	0.534	0.76
58_P	64_G	0.532	0.75
9_A	72_I	0.529	0.75
12_V	70_A	0.525	0.74
11_Y	71_S	0.524	0.74
4_Q	8_V	0.521	0.74
8_V	52_T	0.520	0.74
45_V	56_I	0.519	0.74
24_E	85_K	0.518	0.74
28_F	45_V	0.517	0.73
69_K	115_V	0.516	0.73
83_Y	91_V	0.516	0.73
25_K	116_F	0.514	0.73
63_K	67_Q	0.514	0.73
18_A	35_P	0.513	0.73
4_Q	50_A	0.511	0.73
57_Y	60_A	0.508	0.72
64_G	68_M	0.508	0.72
13_E	18_A	0.507	0.72
59_K	66_E	0.504	0.71
74_F	102_W	0.500	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hc5A	2	1	99.8	0.376	Contact Map
1ss4A	4	0.9917	99.8	0.388	Contact Map
4g6xA	2	0.9917	99.8	0.4	Contact Map
3l20A	2	0.9833	99.8	0.407	Contact Map
3l7tA	2	0.9833	99.8	0.409	Contact Map
3w0tA	2	1	99.8	0.409	Contact Map
3oxhA	1	0.9333	99.8	0.411	Contact Map
3kolA	2	0.9833	99.8	0.412	Contact Map
4lqbA	2	0.9	99.8	0.414	Contact Map
3g12A	2	0.925	99.8	0.414	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.