RHGT2 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RHGT2 - Probable rhamnogalacturonan acetylesterase YesY

UniProt:	O31528	Sequences: MANHIYLAGDSTVQTYGDSTNQGGWGQFLGSHLPEHIQVINRAIGGRSSKTFVEEGRLQAILDVIEPDDWLFVQMGHNDASKNKPERYTEPYTTYKQYLKQYIAGAREKGAHPLLITPVARFHYENGVFLNDFPDYCIAMKQTAAEENVQLIDLMEKSLAFFTEKGEEKVYTYFMISEGINDYTHFTKKGANEMAKLVAKGIKELGLPLTESIIKER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	217 (190)
Sequences:	2543 (1925)
Seq/√Len:	139.7

ECOLI - TESA
BACSU - RHGT2 RHGT1 YXIM YQEF YPMR
SULSO - Q97UG8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
117_T	151_L	4.339	1.00
144_A	151_L	4.087	1.00
96_K	142_Q	3.860	1.00
100_K	146_E	3.851	1.00
115_L	140_M	3.450	1.00
47_R	55_E	3.295	1.00
7_L	13_V	3.254	1.00
71_L	106_A	3.067	1.00
59_Q	63_D	2.590	1.00
100_K	147_E	2.478	1.00
50_K	94_T	2.452	1.00
52_F	75_M	2.408	1.00
49_S	98_Y	2.223	1.00
104_A	147_E	2.211	1.00
8_A	61_I	2.166	1.00
103_I	115_L	2.165	1.00
65_I	111_A	2.155	1.00
119_V	186_F	2.146	1.00
141_K	151_L	2.112	1.00
106_A	111_A	2.071	1.00
156_E	160_A	2.068	1.00
4_H	38_Q	1.965	1.00
95_Y	140_M	1.951	1.00
53_V	101_Q	1.944	1.00
72_F	116_I	1.943	1.00
92_Y	139_A	1.934	1.00
112_H	150_Q	1.917	1.00
138_I	142_Q	1.875	1.00
201_G	204_E	1.833	1.00
96_K	139_A	1.786	1.00
99_L	143_T	1.758	1.00
96_K	146_E	1.699	1.00
53_V	98_Y	1.672	1.00
186_F	194_M	1.619	1.00
73_V	102_Y	1.537	1.00
8_A	52_F	1.483	1.00
103_I	147_E	1.479	1.00
77_H	184_T	1.466	1.00
5_I	37_I	1.404	1.00
72_F	114_L	1.388	1.00
193_E	196_K	1.381	1.00
143_T	147_E	1.379	1.00
49_S	99_L	1.364	1.00
49_S	102_Y	1.341	1.00
22_Q	45_G	1.338	1.00
197_L	200_K	1.334	1.00
157_K	197_L	1.333	1.00
33_L	37_I	1.329	1.00
103_I	143_T	1.312	1.00
16_Y	22_Q	1.292	1.00
4_H	66_E	1.287	1.00
141_K	153_D	1.273	1.00
62_L	65_I	1.265	1.00
85_P	88_Y	1.264	1.00
7_L	26_G	1.232	1.00
169_K	172_T	1.231	1.00
13_V	43_A	1.230	1.00
91_P	94_T	1.213	1.00
153_D	156_E	1.206	1.00
44_I	47_R	1.203	1.00
74_Q	77_H	1.201	1.00
137_C	141_K	1.173	1.00
152_I	201_G	1.168	0.99
72_F	198_V	1.160	0.99
58_L	105_G	1.126	0.99
104_A	107_R	1.123	0.99
139_A	142_Q	1.109	0.99
47_R	51_T	1.107	0.99
168_E	171_Y	1.095	0.99
60_A	63_D	1.093	0.99
157_K	204_E	1.084	0.99
118_P	137_C	1.083	0.99
13_V	72_F	1.069	0.99
97_Q	100_K	1.068	0.99
100_K	104_A	1.068	0.99
116_I	154_L	1.062	0.99
7_L	72_F	1.061	0.99
16_Y	45_G	1.058	0.99
186_F	191_A	1.051	0.99
4_H	40_I	1.050	0.99
97_Q	101_Q	1.046	0.99
70_W	112_H	1.044	0.99
100_K	143_T	1.043	0.99
201_G	205_L	1.042	0.99
99_L	140_M	1.039	0.99
84_K	87_R	1.036	0.99
117_T	141_K	1.035	0.99
71_L	111_A	1.033	0.99
157_K	201_G	1.032	0.99
42_R	60_A	1.031	0.99
13_V	154_L	1.007	0.98
44_I	55_E	1.004	0.98
107_R	149_V	1.002	0.98
31_S	192_N	0.999	0.98
12_T	77_H	0.993	0.98
94_T	97_Q	0.990	0.98
122_F	183_Y	0.990	0.98
59_Q	105_G	0.987	0.98
14_Q	45_G	0.986	0.98
72_F	202_I	0.980	0.98
123_H	130_L	0.978	0.98
147_E	150_Q	0.978	0.98
32_H	196_K	0.974	0.98
53_V	105_G	0.968	0.98
119_V	158_S	0.961	0.98
10_D	74_Q	0.958	0.98
5_I	33_L	0.956	0.98
116_I	198_V	0.950	0.98
50_K	54_E	0.941	0.98
6_Y	61_I	0.940	0.98
101_Q	105_G	0.938	0.98
142_Q	145_A	0.932	0.97
6_Y	40_I	0.931	0.97
27_Q	30_G	0.926	0.97
137_C	155_M	0.925	0.97
58_L	61_I	0.916	0.97
25_W	191_A	0.913	0.97
12_T	74_Q	0.908	0.97
90_E	93_T	0.905	0.97
197_L	201_G	0.901	0.97
93_T	97_Q	0.895	0.97
157_K	200_K	0.890	0.97
62_L	105_G	0.889	0.97
145_A	148_N	0.889	0.97
140_M	143_T	0.886	0.97
13_V	198_V	0.885	0.97
158_S	194_M	0.884	0.97
200_K	204_E	0.866	0.96
32_H	192_N	0.865	0.96
32_H	195_A	0.862	0.96
155_M	159_L	0.857	0.96
117_T	140_M	0.844	0.95
152_I	198_V	0.840	0.95
143_T	149_V	0.839	0.95
107_R	147_E	0.813	0.94
117_T	153_D	0.796	0.94
189_K	192_N	0.794	0.94
96_K	143_T	0.794	0.94
64_V	67_P	0.793	0.94
62_L	109_K	0.781	0.93
110_G	113_P	0.780	0.93
53_V	102_Y	0.779	0.93
94_T	98_Y	0.778	0.93
14_Q	22_Q	0.777	0.93
8_A	58_L	0.769	0.93
11_S	185_H	0.767	0.93
15_T	27_Q	0.766	0.93
154_L	194_M	0.765	0.93
129_F	132_D	0.760	0.92
103_I	107_R	0.753	0.92
105_G	108_E	0.751	0.92
132_D	135_D	0.743	0.91
98_Y	102_Y	0.742	0.91
131_N	155_M	0.741	0.91
118_P	133_F	0.740	0.91
48_S	51_T	0.734	0.91
48_S	89_T	0.732	0.91
158_S	193_E	0.728	0.91
80_A	133_F	0.719	0.90
70_W	202_I	0.716	0.90
5_I	39_V	0.714	0.90
47_R	184_T	0.712	0.90
29_L	33_L	0.709	0.89
98_Y	101_Q	0.709	0.89
152_I	157_K	0.709	0.89
20_T	27_Q	0.707	0.89
138_I	145_A	0.706	0.89
154_L	198_V	0.704	0.89
8_A	75_M	0.700	0.89
61_I	65_I	0.700	0.89
113_P	149_V	0.698	0.89
192_N	196_K	0.693	0.88
115_L	151_L	0.691	0.88
92_Y	135_D	0.690	0.88
104_A	108_E	0.689	0.88
69_D	195_A	0.687	0.88
193_E	197_L	0.684	0.88
134_P	138_I	0.679	0.87
6_Y	68_D	0.676	0.87
90_E	94_T	0.676	0.87
26_G	30_G	0.675	0.87
93_T	96_K	0.674	0.87
186_F	190_G	0.673	0.87
81_S	184_T	0.669	0.86
38_Q	42_R	0.668	0.86
50_K	98_Y	0.668	0.86
119_V	194_M	0.667	0.86
170_V	175_M	0.665	0.86
141_K	145_A	0.662	0.86
156_E	164_E	0.661	0.86
74_Q	119_V	0.660	0.86
40_I	64_V	0.657	0.85
103_I	149_V	0.655	0.85
11_S	78_N	0.655	0.85
23_G	28_F	0.654	0.85
14_Q	44_I	0.651	0.85
33_L	70_W	0.648	0.85
202_I	205_L	0.646	0.85
143_T	146_E	0.645	0.84
116_I	194_M	0.644	0.84
182_D	185_H	0.640	0.84
135_D	138_I	0.639	0.84
5_I	72_F	0.639	0.84
88_Y	92_Y	0.638	0.84
134_P	137_C	0.636	0.84
95_Y	136_Y	0.635	0.84
172_T	189_K	0.633	0.83
6_Y	42_R	0.633	0.83
28_F	31_S	0.633	0.83
167_E	170_V	0.627	0.83
58_L	102_Y	0.625	0.83
115_L	144_A	0.624	0.82
196_K	200_K	0.622	0.82
14_Q	43_A	0.619	0.82
20_T	23_G	0.617	0.82
12_T	15_T	0.615	0.82
115_L	143_T	0.613	0.81
65_I	71_L	0.610	0.81
32_H	152_I	0.610	0.81
9_G	13_V	0.608	0.81
78_N	185_H	0.608	0.81
77_H	133_F	0.608	0.81
120_A	159_L	0.600	0.80
77_H	119_V	0.600	0.80
80_A	118_P	0.595	0.79
25_W	28_F	0.594	0.79
157_K	160_A	0.589	0.79
96_K	100_K	0.585	0.78
7_L	198_V	0.576	0.77
70_W	150_Q	0.575	0.77
130_L	133_F	0.573	0.77
65_I	68_D	0.570	0.76
82_K	87_R	0.570	0.76
8_A	102_Y	0.568	0.76
122_F	170_V	0.567	0.76
4_H	69_D	0.567	0.76
141_K	156_E	0.565	0.76
22_Q	26_G	0.565	0.76
46_G	78_N	0.563	0.76
74_Q	184_T	0.562	0.75
167_E	171_Y	0.562	0.75
47_R	75_M	0.560	0.75
166_G	170_V	0.558	0.75
23_G	27_Q	0.552	0.74
99_L	103_I	0.547	0.73
9_G	75_M	0.546	0.73
27_Q	31_S	0.545	0.73
105_G	109_K	0.544	0.73
20_T	24_G	0.543	0.73
61_I	106_A	0.542	0.73
140_M	144_A	0.541	0.73
42_R	61_I	0.541	0.73
124_Y	170_V	0.541	0.73
181_N	187_T	0.539	0.72
200_K	203_K	0.538	0.72
123_H	183_Y	0.537	0.72
99_L	115_L	0.536	0.72
74_Q	154_L	0.535	0.72
52_F	102_Y	0.533	0.72
62_L	108_E	0.532	0.71
12_T	119_V	0.530	0.71
82_K	88_Y	0.526	0.71
28_F	195_A	0.526	0.71
30_G	33_L	0.524	0.70
45_G	81_S	0.524	0.70
51_T	54_E	0.523	0.70
93_T	139_A	0.522	0.70
28_F	192_N	0.522	0.70
6_Y	71_L	0.521	0.70
127_G	130_L	0.520	0.70
29_L	39_V	0.517	0.69
189_K	193_E	0.515	0.69
156_E	159_L	0.513	0.69
7_L	39_V	0.513	0.69
8_A	106_A	0.512	0.69
73_V	115_L	0.512	0.69
21_N	24_G	0.510	0.68
71_L	105_G	0.507	0.68
35_E	38_Q	0.506	0.68
76_G	182_D	0.504	0.67
43_A	102_Y	0.501	0.67
12_T	186_F	0.501	0.67
133_F	137_C	0.500	0.67
118_P	155_M	0.500	0.67
118_P	140_M	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1k7cA	1	0.9585	100	0.33	Contact Map
2o14A	1	0.9217	100	0.385	Contact Map
3milA	2	0.9355	100	0.388	Contact Map
2q0qA	5	0.8341	100	0.392	Contact Map
1yzfA	1	0.871	100	0.411	Contact Map
4jhlA	5	0.9124	100	0.412	Contact Map
3hp4A	1	0.8203	100	0.413	Contact Map
4q9aA	2	0.8894	100	0.413	Contact Map
3rjtA	2	0.8894	100	0.416	Contact Map
1vjgA	2	0.8894	100	0.421	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.