YESV - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YESV - Uncharacterized protein YesV

UniProt:	O31525	Sequences: MKTTVTDALYAGCEAVVKIAWLNGLWLLFTLLGGVLFGWAPSTAAMCAVIRKWLMGQKDVPIFSLFLDTYKKEFLKVNAIGLAFSALLLILSANYHYFSASTNWLSFAVTSCTLLAGLLYIIALMYVFPLYVHYQLPLRKYIPQALLFGAMRPLTTGCMLIGCGFVLYLLYTLPGLIPFYGPCLFGLVLMFFALRGFQKTEAQHHQAG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (191)
Sequences:	1117 (1020)
Seq/√Len:	73.8

BACSU - YESV YTEU YESL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_W	43_T	7.385	1.00
29_F	66_F	4.061	1.00
126_Y	156_T	3.836	1.00
41_P	78_N	3.729	1.00
29_F	67_L	3.625	1.00
46_M	186_G	3.244	1.00
88_L	120_Y	2.864	1.00
35_V	38_G	2.835	1.00
48_A	69_T	2.383	1.00
26_W	46_M	2.371	1.00
30_T	38_G	2.323	1.00
26_W	182_P	2.298	1.00
92_S	96_H	2.275	1.00
78_N	81_G	2.258	1.00
80_I	127_V	2.185	1.00
40_A	81_G	2.141	1.00
44_A	77_V	2.135	1.00
23_N	183_C	2.134	1.00
12_G	16_V	2.081	1.00
90_I	94_N	1.940	1.00
38_G	78_N	1.939	1.00
122_I	149_G	1.908	1.00
134_Y	201_E	1.903	1.00
31_L	35_V	1.863	1.00
84_F	123_A	1.816	1.00
137_P	140_K	1.791	1.00
30_T	39_W	1.790	1.00
63_F	67_L	1.776	1.00
19_I	187_L	1.754	1.00
74_F	78_N	1.721	1.00
38_G	41_P	1.710	1.00
19_I	183_C	1.689	1.00
30_T	35_V	1.645	1.00
21_W	63_F	1.615	0.99
69_T	73_E	1.614	0.99
123_A	146_L	1.587	0.99
51_R	133_H	1.571	0.99
84_F	127_V	1.554	0.99
8_A	11_A	1.551	0.99
22_L	46_M	1.533	0.99
136_L	141_Y	1.526	0.99
7_D	10_Y	1.513	0.99
152_R	200_T	1.479	0.99
14_E	18_K	1.460	0.99
15_A	18_K	1.419	0.99
29_F	70_Y	1.368	0.98
84_F	124_L	1.366	0.98
155_T	195_R	1.365	0.98
37_F	74_F	1.280	0.97
133_H	201_E	1.274	0.97
122_I	156_T	1.274	0.97
29_F	42_S	1.253	0.97
143_P	147_L	1.241	0.97
90_I	97_Y	1.236	0.97
23_N	27_L	1.228	0.97
35_V	78_N	1.228	0.97
68_D	72_K	1.208	0.96
41_P	81_G	1.207	0.96
29_F	71_K	1.203	0.96
61_P	64_S	1.202	0.96
80_I	131_Y	1.200	0.96
47_C	190_M	1.197	0.96
79_A	138_L	1.195	0.96
74_F	77_V	1.184	0.96
21_W	25_L	1.184	0.96
48_A	52_K	1.165	0.95
163_C	189_L	1.163	0.95
55_M	194_L	1.157	0.95
41_P	70_Y	1.154	0.95
20_A	180_Y	1.153	0.95
76_K	135_Q	1.152	0.95
51_R	190_M	1.147	0.95
46_M	182_P	1.138	0.95
77_V	80_I	1.132	0.95
75_L	79_A	1.115	0.94
159_M	192_F	1.106	0.94
88_L	91_L	1.095	0.94
47_C	129_P	1.088	0.93
127_V	142_I	1.084	0.93
170_L	177_I	1.083	0.93
23_N	182_P	1.083	0.93
17_V	20_A	1.067	0.93
126_Y	129_P	1.059	0.92
77_V	81_G	1.052	0.92
47_C	186_G	1.046	0.92
136_L	144_Q	1.039	0.92
152_R	196_G	1.039	0.92
52_K	57_Q	1.038	0.92
134_Y	200_T	1.035	0.91
81_G	128_F	1.025	0.91
44_A	73_E	1.024	0.91
50_I	190_M	1.010	0.90
61_P	65_L	0.992	0.90
41_P	44_A	0.976	0.89
91_L	120_Y	0.973	0.89
134_Y	197_F	0.972	0.89
38_G	70_Y	0.969	0.89
118_L	121_I	0.969	0.89
129_P	197_F	0.967	0.88
26_W	30_T	0.959	0.88
80_I	138_L	0.958	0.88
37_F	82_L	0.958	0.88
94_N	113_T	0.957	0.88
84_F	128_F	0.947	0.87
50_I	186_G	0.935	0.87
19_I	23_N	0.931	0.86
175_G	178_P	0.931	0.86
130_L	144_Q	0.931	0.86
152_R	199_K	0.926	0.86
87_L	91_L	0.921	0.86
10_Y	14_E	0.914	0.85
52_K	69_T	0.911	0.85
49_V	53_W	0.907	0.85
91_L	116_A	0.905	0.85
163_C	167_L	0.905	0.85
94_N	98_F	0.905	0.85
48_A	132_V	0.903	0.85
10_Y	13_C	0.902	0.85
42_S	70_Y	0.897	0.84
83_A	142_I	0.881	0.83
45_A	69_T	0.879	0.83
9_L	13_C	0.875	0.83
182_P	186_G	0.860	0.82
51_R	132_V	0.855	0.81
70_Y	74_F	0.848	0.81
26_W	29_F	0.846	0.81
50_I	53_W	0.843	0.80
98_F	170_L	0.834	0.80
44_A	131_Y	0.829	0.79
46_M	50_I	0.828	0.79
18_K	21_W	0.821	0.79
87_L	120_Y	0.821	0.79
47_C	193_A	0.821	0.79
54_L	57_Q	0.816	0.78
7_D	14_E	0.811	0.78
120_Y	124_L	0.804	0.77
78_N	131_Y	0.802	0.77
162_G	188_V	0.798	0.77
30_T	36_L	0.797	0.77
70_Y	78_N	0.793	0.76
167_L	171_Y	0.786	0.76
26_W	66_F	0.784	0.75
159_M	193_A	0.781	0.75
102_T	118_L	0.778	0.75
43_T	51_R	0.777	0.75
188_V	191_F	0.769	0.74
124_L	128_F	0.767	0.74
52_K	60_V	0.765	0.74
37_F	78_N	0.759	0.73
39_W	182_P	0.756	0.73
140_K	143_P	0.747	0.72
38_G	82_L	0.742	0.71
186_G	190_M	0.739	0.71
88_L	124_L	0.735	0.71
155_T	192_F	0.734	0.71
22_L	126_Y	0.734	0.71
30_T	78_N	0.734	0.71
96_H	100_A	0.722	0.69
40_A	77_V	0.721	0.69
164_G	167_L	0.714	0.68
123_A	142_I	0.711	0.68
16_V	94_N	0.710	0.68
136_L	140_K	0.709	0.68
59_D	65_L	0.705	0.67
96_H	99_S	0.699	0.67
155_T	187_L	0.695	0.66
13_C	22_L	0.693	0.66
55_M	134_Y	0.693	0.66
66_F	127_V	0.688	0.66
22_L	50_I	0.680	0.65
89_L	178_P	0.678	0.64
30_T	41_P	0.678	0.64
126_Y	197_F	0.677	0.64
165_F	174_P	0.674	0.64
81_G	85_S	0.673	0.64
23_N	81_G	0.666	0.63
10_Y	98_F	0.664	0.63
111_S	115_L	0.662	0.63
111_S	114_L	0.660	0.62
107_F	142_I	0.659	0.62
152_R	155_T	0.658	0.62
37_F	161_I	0.658	0.62
97_Y	143_P	0.657	0.62
18_K	38_G	0.656	0.62
52_K	133_H	0.655	0.62
141_Y	145_A	0.654	0.62
194_L	198_Q	0.653	0.62
100_A	130_L	0.653	0.62
12_G	27_L	0.652	0.61
132_V	136_L	0.649	0.61
117_G	121_I	0.646	0.61
25_L	67_L	0.646	0.61
18_K	53_W	0.642	0.60
145_A	183_C	0.637	0.60
65_L	147_L	0.636	0.60
158_C	161_I	0.633	0.59
19_I	182_P	0.633	0.59
50_I	187_L	0.632	0.59
47_C	189_L	0.632	0.59
123_A	129_P	0.631	0.59
51_R	55_M	0.628	0.59
95_Y	110_T	0.624	0.58
102_T	105_L	0.622	0.58
36_L	155_T	0.621	0.58
26_W	47_C	0.620	0.58
15_A	53_W	0.616	0.57
65_L	69_T	0.612	0.57
25_L	30_T	0.612	0.57
64_S	68_D	0.610	0.56
64_S	158_C	0.608	0.56
132_V	197_F	0.600	0.55
39_W	81_G	0.599	0.55
23_N	181_G	0.599	0.55
130_L	136_L	0.598	0.55
157_G	161_I	0.596	0.55
76_K	79_A	0.594	0.54
31_L	81_G	0.593	0.54
166_V	181_G	0.589	0.54
115_L	134_Y	0.587	0.54
36_L	85_S	0.586	0.53
73_E	76_K	0.583	0.53
78_N	141_Y	0.583	0.53
28_L	199_K	0.576	0.52
148_F	200_T	0.575	0.52
52_K	65_L	0.573	0.52
19_I	166_V	0.573	0.52
69_T	72_K	0.572	0.52
52_K	180_Y	0.570	0.51
67_L	71_K	0.566	0.51
13_C	166_V	0.565	0.51
49_V	69_T	0.564	0.51
28_L	185_F	0.563	0.51
138_L	141_Y	0.562	0.50
79_A	83_A	0.560	0.50
159_M	189_L	0.559	0.50
186_G	197_F	0.558	0.50
181_G	185_F	0.557	0.50
50_I	54_L	0.555	0.50
127_V	141_Y	0.555	0.50
170_L	181_G	0.551	0.49
167_L	185_F	0.550	0.49
126_Y	193_A	0.550	0.49
122_I	160_L	0.549	0.49
130_L	152_R	0.545	0.48
83_A	103_N	0.545	0.48
164_G	171_Y	0.545	0.48
144_Q	148_F	0.542	0.48
53_W	59_D	0.542	0.48
95_Y	150_A	0.541	0.48
198_Q	201_E	0.540	0.48
91_L	113_T	0.539	0.48
40_A	133_H	0.539	0.48
54_L	187_L	0.533	0.47
129_P	190_M	0.531	0.47
67_L	70_Y	0.530	0.46
19_I	50_I	0.525	0.46
130_L	141_Y	0.525	0.46
131_Y	196_G	0.524	0.46
154_L	187_L	0.524	0.46
42_S	45_A	0.522	0.45
15_A	187_L	0.521	0.45
7_D	16_V	0.520	0.45
121_I	160_L	0.519	0.45
69_T	131_Y	0.516	0.45
146_L	158_C	0.515	0.45
62_I	80_I	0.515	0.45
128_F	156_T	0.515	0.45
182_P	187_L	0.513	0.44
29_F	38_G	0.513	0.44
94_N	144_Q	0.511	0.44
129_P	186_G	0.509	0.44
10_Y	27_L	0.508	0.44
144_Q	147_L	0.508	0.44
82_L	86_A	0.507	0.44
25_L	62_I	0.506	0.43
47_C	51_R	0.506	0.43
135_Q	138_L	0.505	0.43
153_P	157_G	0.505	0.43
196_G	200_T	0.505	0.43
41_P	60_V	0.504	0.43
84_F	145_A	0.504	0.43
66_F	69_T	0.502	0.43
100_A	162_G	0.502	0.43
22_L	192_F	0.502	0.43
154_L	195_R	0.502	0.43
168_Y	185_F	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zy9A	2	0.7548	15.8	0.939	Contact Map
3w4tA	1	0.9038	13.2	0.941	Contact Map
4pl0A	2	0.726	13	0.941	Contact Map
2k1eA	3	0.4856	8.3	0.946	Contact Map
3b5xA	2	0.7019	7.7	0.947	Contact Map
4q4hA	1	0.7019	6.3	0.949	Contact Map
3b60A	2	0.6875	6	0.95	Contact Map
3effK	4	0.5	5.5	0.951	Contact Map
4h33A	3	0.4279	4.9	0.952	Contact Map
3l1lA	2	0.8365	4.5	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.