RHGT1 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RHGT1 - Rhamnogalacturonan acetylesterase RhgT

UniProt:	O31523	Sequences: MMKKPIQVFLAGDSTVSDCPPHEAPMAGWGQVFGQLFSEGVLVRNHAKGGASTNSFVEEGRLQAIAEHITQGDYLLIQFGHNDQKPRGTKPYSTFQQFLTLFADTAREKGAHPVFVTSVQRRRFDENGRIEHTLGEYPDAMKALAKELDVPVIDLLAKTKVLYEAYGPEESKRLFVWFQPNEHPNYPDGIEDNTHFSEKGAMEVAKLVAEGIEELGLPLKDHLVSREGKEHV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	232 (193)
Sequences:	2575 (1915)
Seq/√Len:	137.9

ECOLI - TESA
BACSU - RHGT1 RHGT2 YXIM YQEF YPMR
SULSO - Q97UG8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
117_T	152_V	4.556	1.00
145_A	152_V	4.034	1.00
96_Q	143_A	3.981	1.00
100_T	147_E	3.977	1.00
51_A	59_E	3.406	1.00
115_F	141_M	3.363	1.00
10_L	16_V	3.287	1.00
75_L	106_A	3.105	1.00
104_D	148_L	2.493	1.00
100_T	148_L	2.493	1.00
56_F	79_F	2.439	1.00
11_A	65_I	2.429	1.00
54_N	94_T	2.350	1.00
53_T	98_F	2.233	1.00
142_K	152_V	2.200	1.00
106_A	111_A	2.132	1.00
119_V	196_F	2.131	1.00
76_L	116_V	2.095	1.00
103_A	115_F	2.077	1.00
95_F	141_M	2.067	1.00
157_A	161_V	2.031	1.00
63_Q	67_E	2.027	1.00
139_D	143_A	1.974	1.00
69_I	111_A	1.969	1.00
211_G	214_E	1.955	1.00
99_L	144_L	1.933	1.00
92_Y	140_A	1.919	1.00
57_V	101_L	1.894	1.00
7_Q	42_L	1.875	1.00
112_H	151_P	1.840	1.00
96_Q	140_A	1.781	1.00
77_I	102_F	1.679	1.00
103_A	148_L	1.647	1.00
96_Q	147_E	1.621	1.00
57_V	98_F	1.605	1.00
196_F	204_V	1.558	1.00
11_A	56_F	1.546	1.00
81_H	194_T	1.478	1.00
8_V	41_V	1.466	1.00
16_V	47_A	1.419	1.00
203_E	206_K	1.412	1.00
53_T	102_F	1.396	1.00
76_L	114_V	1.382	1.00
53_T	99_L	1.378	1.00
6_I	41_V	1.375	1.00
37_F	41_V	1.366	1.00
154_D	157_A	1.362	1.00
48_K	61_R	1.333	1.00
158_K	207_L	1.316	1.00
62_L	105_T	1.303	1.00
26_M	49_G	1.290	1.00
91_P	94_T	1.287	1.00
170_E	173_R	1.276	1.00
142_K	154_D	1.269	1.00
144_L	148_L	1.264	1.00
19_C	26_M	1.264	1.00
10_L	30_G	1.251	1.00
103_A	144_L	1.238	1.00
207_L	210_E	1.236	1.00
138_P	142_K	1.217	1.00
7_Q	70_T	1.211	1.00
46_H	64_A	1.210	1.00
78_Q	81_H	1.193	1.00
48_K	51_A	1.175	0.99
158_K	214_E	1.168	0.99
140_A	143_A	1.167	0.99
97_Q	100_T	1.161	0.99
162_L	166_Y	1.144	0.99
158_K	211_G	1.136	0.99
104_D	107_R	1.128	0.99
118_S	138_P	1.127	0.99
19_C	49_G	1.121	0.99
66_A	69_I	1.120	0.99
122_R	193_N	1.114	0.99
169_E	172_K	1.106	0.99
94_T	97_Q	1.105	0.99
16_V	155_L	1.096	0.99
99_L	141_M	1.095	0.99
66_A	105_T	1.094	0.99
90_K	93_S	1.081	0.99
100_T	104_D	1.072	0.99
100_T	144_L	1.055	0.99
123_R	131_E	1.053	0.99
153_I	211_G	1.052	0.99
211_G	215_L	1.034	0.99
51_A	55_S	1.030	0.99
119_V	159_T	1.023	0.99
76_L	212_I	1.019	0.99
97_Q	101_L	1.013	0.98
7_Q	44_R	1.013	0.98
16_V	76_L	1.012	0.98
35_Q	202_M	1.006	0.98
74_Y	112_H	0.994	0.98
76_L	208_V	0.987	0.98
117_T	142_K	0.985	0.98
15_T	81_H	0.981	0.98
64_A	67_E	0.978	0.98
54_N	58_E	0.977	0.98
9_F	44_R	0.975	0.98
101_L	105_T	0.966	0.98
107_R	150_V	0.961	0.98
107_R	148_L	0.958	0.98
196_F	201_A	0.950	0.98
15_T	78_Q	0.947	0.98
17_S	49_G	0.946	0.98
13_D	78_Q	0.945	0.98
141_M	144_L	0.938	0.97
33_F	37_F	0.925	0.97
116_V	208_V	0.924	0.97
61_R	102_F	0.920	0.97
29_W	201_A	0.915	0.97
57_V	105_T	0.914	0.97
117_T	141_M	0.911	0.97
16_V	208_V	0.908	0.97
103_A	107_R	0.904	0.97
36_L	206_K	0.897	0.97
162_L	174_L	0.897	0.97
116_V	155_L	0.897	0.97
36_L	202_M	0.896	0.97
159_T	204_V	0.893	0.97
110_G	113_P	0.889	0.97
153_I	216_G	0.885	0.96
93_S	96_Q	0.883	0.96
66_A	109_K	0.883	0.96
62_L	65_I	0.882	0.96
210_E	214_E	0.877	0.96
48_K	59_E	0.875	0.96
199_K	202_M	0.873	0.96
10_L	76_L	0.865	0.96
9_F	65_I	0.865	0.96
156_L	160_K	0.856	0.96
158_K	210_E	0.852	0.96
207_L	211_G	0.850	0.96
143_A	146_K	0.844	0.95
17_S	26_M	0.834	0.95
138_P	156_L	0.826	0.95
144_L	150_V	0.826	0.95
8_V	37_F	0.824	0.95
52_S	55_S	0.823	0.95
146_K	149_D	0.819	0.95
117_T	154_D	0.819	0.95
155_L	204_V	0.807	0.94
96_Q	144_L	0.790	0.93
118_S	134_L	0.788	0.93
153_I	208_V	0.783	0.93
133_T	136_E	0.781	0.93
132_H	156_L	0.781	0.93
157_A	165_A	0.778	0.93
93_S	97_Q	0.765	0.92
75_L	111_A	0.762	0.92
23_E	27_A	0.761	0.92
24_A	27_A	0.743	0.91
52_S	89_T	0.743	0.91
69_I	72_G	0.742	0.91
98_F	102_F	0.739	0.91
57_V	102_F	0.739	0.91
8_V	33_F	0.730	0.90
32_V	202_M	0.729	0.90
65_I	69_I	0.729	0.90
84_Q	134_L	0.728	0.90
36_L	205_A	0.726	0.90
92_Y	136_E	0.724	0.90
98_F	101_L	0.720	0.90
155_L	208_V	0.716	0.90
69_I	75_L	0.715	0.89
159_T	203_E	0.713	0.89
135_G	139_D	0.705	0.89
8_V	76_L	0.705	0.89
95_F	137_Y	0.702	0.89
125_D	128_G	0.701	0.89
119_V	204_V	0.698	0.88
130_I	133_T	0.694	0.88
125_D	129_R	0.690	0.88
81_H	119_V	0.683	0.87
104_D	108_E	0.683	0.87
11_A	69_I	0.682	0.87
148_L	151_P	0.678	0.87
11_A	79_F	0.673	0.86
94_T	98_F	0.673	0.86
90_K	94_T	0.671	0.86
24_A	31_Q	0.671	0.86
8_V	43_V	0.667	0.86
27_A	32_V	0.666	0.86
113_P	150_V	0.663	0.86
162_L	207_L	0.663	0.86
78_Q	119_V	0.660	0.85
115_F	145_A	0.659	0.85
18_D	31_Q	0.659	0.85
142_K	157_A	0.656	0.85
96_Q	100_T	0.655	0.85
97_Q	104_D	0.655	0.85
103_A	150_V	0.652	0.85
44_R	68_H	0.648	0.84
202_M	206_K	0.648	0.84
32_V	205_A	0.646	0.84
73_D	205_A	0.642	0.84
15_T	18_D	0.641	0.84
62_L	67_E	0.640	0.84
203_E	207_L	0.639	0.83
74_Y	212_I	0.637	0.83
158_K	161_V	0.636	0.83
105_T	108_E	0.636	0.83
120_Q	160_K	0.635	0.83
139_D	146_K	0.632	0.83
171_S	176_V	0.631	0.83
149_D	206_K	0.631	0.83
42_L	46_H	0.628	0.82
212_I	215_L	0.625	0.82
61_R	64_A	0.616	0.81
31_Q	34_G	0.616	0.81
87_R	91_P	0.614	0.81
34_G	43_V	0.611	0.81
9_F	69_I	0.607	0.80
50_G	82_N	0.605	0.80
153_I	158_K	0.604	0.80
85_K	194_T	0.602	0.80
62_L	102_F	0.602	0.80
173_R	199_K	0.601	0.80
12_G	16_V	0.600	0.79
77_I	115_F	0.600	0.79
62_L	75_L	0.598	0.79
74_Y	151_P	0.596	0.79
131_E	134_L	0.595	0.79
10_L	33_F	0.592	0.79
122_R	171_S	0.586	0.78
105_T	109_K	0.586	0.78
144_L	147_E	0.585	0.78
36_L	153_I	0.584	0.78
115_F	144_L	0.584	0.78
54_N	98_F	0.582	0.77
99_L	115_F	0.581	0.77
88_G	91_P	0.581	0.77
9_F	46_H	0.580	0.77
51_A	194_T	0.579	0.77
118_S	156_L	0.579	0.77
168_P	171_S	0.578	0.77
78_Q	194_T	0.577	0.77
142_K	146_K	0.575	0.77
196_F	200_G	0.574	0.76
10_L	208_V	0.573	0.76
17_S	47_A	0.573	0.76
39_E	42_L	0.572	0.76
113_P	118_S	0.571	0.76
78_Q	116_V	0.569	0.76
51_A	61_R	0.568	0.76
88_G	93_S	0.566	0.75
206_K	210_E	0.564	0.75
49_G	85_K	0.563	0.75
121_R	194_T	0.563	0.75
46_H	61_R	0.562	0.75
51_A	79_F	0.562	0.75
52_S	88_G	0.559	0.75
11_A	106_A	0.558	0.74
30_G	34_G	0.557	0.74
205_A	209_A	0.555	0.74
116_V	204_V	0.555	0.74
122_R	125_D	0.555	0.74
14_S	195_H	0.554	0.74
55_S	58_E	0.549	0.73
12_G	79_F	0.547	0.73
95_F	99_L	0.545	0.73
11_A	102_F	0.544	0.73
107_R	113_P	0.544	0.73
17_S	48_K	0.544	0.73
85_K	88_G	0.542	0.72
9_F	75_L	0.538	0.72
5_P	42_L	0.538	0.72
56_F	102_F	0.535	0.71
87_R	93_S	0.534	0.71
9_F	72_G	0.533	0.71
46_H	65_I	0.530	0.71
27_A	31_Q	0.529	0.70
63_Q	105_T	0.524	0.70
86_P	89_T	0.523	0.70
199_K	203_E	0.523	0.70
126_E	210_E	0.522	0.69
134_L	138_P	0.521	0.69
81_H	134_L	0.518	0.69
175_F	191_E	0.515	0.68
206_K	209_A	0.515	0.68
173_R	176_V	0.510	0.68
10_L	47_A	0.510	0.68
103_A	113_P	0.510	0.68
143_A	147_E	0.509	0.68
15_T	119_V	0.508	0.67
93_S	140_A	0.506	0.67
94_T	149_D	0.506	0.67
120_Q	159_T	0.505	0.67
88_G	92_Y	0.505	0.67
166_Y	170_E	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1k7cA	1	0.9009	100	0.387	Contact Map
2o14A	1	0.8922	100	0.404	Contact Map
3milA	2	0.9009	100	0.427	Contact Map
4jhlA	5	0.8534	100	0.441	Contact Map
1yzfA	1	0.819	100	0.446	Contact Map
3rjtA	2	0.8319	100	0.448	Contact Map
4q9aA	2	0.8362	100	0.448	Contact Map
2q0qA	5	0.7888	100	0.449	Contact Map
4rw0A	1	0.7802	100	0.454	Contact Map
1vjgA	2	0.8319	100	0.458	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.