YESL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YESL - Uncharacterized protein YesL

UniProt:	O31515	Sequences: MLMIHSVANGLNHFCTWVMRLAYLNVLWILFSLAGLVVFGLMPATAAMFTVAREWAKGNTDAPVFSVFFRTFKKEWRASQILGLIVVTAALFLFADMRIAAQMDQPVLVNVFVSISLIFAFVVLYVFPVFSHFDVKIREVLSISFFIAFSRPAVTLLMAAGAVGVLCLVLFHVTFLLFFSGSLLSLILTKLSFKAFRSMDQRQEKEKAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	209 (191)
Sequences:	1175 (1068)
Seq/√Len:	77.2

BACSU - YESL YTEU YESV

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_W	45_T	7.757	1.00
31_F	68_F	4.266	1.00
125_Y	155_T	3.979	1.00
31_F	69_F	3.942	1.00
43_P	80_Q	3.870	1.00
48_M	185_S	3.142	1.00
90_A	119_F	2.862	1.00
34_A	40_G	2.789	1.00
25_N	182_S	2.602	1.00
82_L	126_V	2.431	1.00
50_T	71_T	2.407	1.00
28_W	48_M	2.391	1.00
80_Q	83_G	2.295	1.00
28_W	181_G	2.270	1.00
42_M	83_G	2.242	1.00
32_S	40_G	2.205	1.00
94_F	98_R	2.195	1.00
40_G	80_Q	2.125	1.00
46_A	79_S	2.101	1.00
136_K	139_E	2.071	1.00
21_L	182_S	1.983	1.00
121_F	148_A	1.977	1.00
133_F	200_D	1.971	1.00
86_V	122_V	1.968	1.00
92_F	96_D	1.939	1.00
76_W	80_Q	1.891	1.00
32_S	41_L	1.873	1.00
40_G	43_P	1.801	1.00
21_L	186_L	1.797	1.00
14_F	18_V	1.752	1.00
65_F	69_F	1.713	1.00
24_L	48_M	1.677	1.00
122_V	145_F	1.652	1.00
23_Y	65_F	1.629	1.00
71_T	75_E	1.569	0.99
53_R	132_H	1.565	0.99
86_V	126_V	1.558	0.99
9_N	12_N	1.554	0.99
135_V	140_V	1.521	0.99
39_F	76_W	1.495	0.99
16_T	20_R	1.490	0.99
154_V	194_K	1.424	0.99
151_R	199_M	1.369	0.99
92_F	99_I	1.348	0.98
31_F	72_F	1.345	0.98
158_M	191_L	1.333	0.98
17_W	20_R	1.318	0.98
76_W	79_S	1.304	0.98
79_S	82_L	1.302	0.98
132_H	200_D	1.293	0.98
10_G	13_H	1.281	0.98
86_V	123_V	1.277	0.98
63_P	66_S	1.275	0.98
43_P	72_F	1.255	0.97
23_Y	27_L	1.255	0.97
142_S	146_F	1.234	0.97
22_A	179_F	1.228	0.97
31_F	44_A	1.202	0.97
25_N	181_G	1.201	0.97
25_N	29_I	1.201	0.97
77_R	81_I	1.197	0.97
34_A	80_Q	1.194	0.96
31_F	73_K	1.193	0.96
49_F	189_T	1.184	0.96
70_R	74_K	1.179	0.96
81_I	137_I	1.178	0.96
32_S	38_V	1.160	0.96
28_W	32_S	1.156	0.96
43_P	83_G	1.155	0.96
162_A	188_L	1.143	0.95
50_T	54_E	1.129	0.95
128_P	196_F	1.109	0.95
162_A	166_L	1.105	0.95
135_V	143_I	1.098	0.94
48_M	181_G	1.098	0.94
78_A	134_D	1.085	0.94
49_F	128_P	1.084	0.94
46_A	75_E	1.078	0.94
39_F	84_L	1.076	0.94
121_F	155_T	1.054	0.93
161_G	187_I	1.049	0.93
133_F	199_M	1.048	0.93
79_S	83_G	1.041	0.93
125_Y	128_P	1.041	0.93
82_L	130_F	1.041	0.93
49_F	185_S	1.037	0.92
181_G	185_S	1.030	0.92
44_A	72_F	1.020	0.92
53_R	189_T	1.019	0.92
82_L	137_I	1.018	0.92
21_L	25_N	1.017	0.92
110_N	114_S	1.008	0.91
151_R	195_A	0.993	0.91
51_V	55_W	0.980	0.90
57_K	193_F	0.976	0.90
56_A	59_N	0.970	0.90
96_D	112_F	0.959	0.89
93_L	119_F	0.957	0.89
52_A	189_T	0.954	0.89
90_A	93_L	0.947	0.89
63_P	67_V	0.944	0.88
54_E	59_N	0.944	0.88
19_M	22_A	0.944	0.88
43_P	46_A	0.941	0.88
11_L	15_C	0.931	0.88
40_G	72_F	0.929	0.88
46_A	130_F	0.927	0.87
47_A	71_T	0.910	0.87
20_R	23_Y	0.893	0.85
129_V	143_I	0.890	0.85
169_V	176_L	0.886	0.85
52_A	55_W	0.882	0.85
133_F	196_F	0.881	0.85
48_M	52_A	0.880	0.85
96_D	100_A	0.873	0.84
42_M	79_S	0.873	0.84
41_L	181_G	0.872	0.84
83_G	127_F	0.858	0.83
119_F	123_V	0.857	0.83
24_L	125_Y	0.856	0.83
50_T	131_S	0.854	0.83
85_I	141_L	0.854	0.83
89_A	93_L	0.849	0.82
185_S	189_T	0.848	0.82
52_A	185_S	0.839	0.82
72_F	76_W	0.827	0.81
40_G	84_L	0.827	0.81
12_N	16_T	0.818	0.80
93_L	115_I	0.814	0.80
54_E	71_T	0.810	0.79
90_A	123_V	0.810	0.79
80_Q	130_F	0.807	0.79
166_L	170_L	0.804	0.79
140_V	144_S	0.801	0.79
151_R	198_S	0.796	0.78
45_T	53_R	0.793	0.78
86_V	127_F	0.792	0.78
158_M	192_S	0.779	0.77
30_L	34_A	0.779	0.77
8_A	20_R	0.776	0.76
89_A	119_F	0.776	0.76
135_V	139_E	0.774	0.76
28_W	31_F	0.772	0.76
152_P	156_L	0.769	0.76
164_G	177_L	0.768	0.76
34_A	39_F	0.765	0.75
12_N	15_C	0.753	0.74
49_F	188_L	0.745	0.73
39_F	80_Q	0.745	0.73
163_V	166_L	0.738	0.73
125_Y	196_F	0.736	0.73
126_V	141_L	0.735	0.72
120_A	163_V	0.730	0.72
8_A	16_T	0.730	0.72
49_F	192_S	0.730	0.72
139_E	142_S	0.724	0.71
98_R	102_Q	0.721	0.71
154_V	191_L	0.711	0.70
69_F	72_F	0.710	0.70
32_S	43_P	0.709	0.70
54_E	132_H	0.702	0.69
32_S	80_Q	0.702	0.69
54_E	62_A	0.700	0.69
83_G	87_V	0.699	0.69
53_R	57_K	0.699	0.69
122_V	128_P	0.696	0.68
25_N	83_G	0.692	0.68
187_I	190_K	0.689	0.68
33_L	83_G	0.688	0.67
72_F	80_Q	0.686	0.67
9_N	16_T	0.673	0.66
30_L	91_L	0.672	0.66
61_D	67_V	0.670	0.65
69_F	73_K	0.667	0.65
154_V	186_L	0.667	0.65
28_W	49_F	0.665	0.65
12_N	100_A	0.659	0.64
28_W	68_F	0.658	0.64
20_R	55_W	0.654	0.64
122_V	141_L	0.651	0.63
117_L	120_A	0.649	0.63
27_L	32_S	0.647	0.63
114_S	133_F	0.644	0.62
20_R	40_G	0.643	0.62
14_F	29_I	0.639	0.62
169_V	180_S	0.638	0.62
143_I	147_I	0.634	0.61
68_F	126_V	0.630	0.61
85_I	171_F	0.626	0.60
165_V	180_S	0.625	0.60
147_I	199_M	0.624	0.60
98_R	101_A	0.622	0.60
145_F	157_L	0.621	0.60
162_A	184_L	0.618	0.59
167_C	171_F	0.618	0.59
66_S	157_L	0.614	0.59
134_D	163_V	0.613	0.59
102_Q	161_G	0.613	0.59
96_D	143_I	0.613	0.59
67_V	71_T	0.611	0.58
101_A	104_D	0.611	0.58
120_A	198_S	0.611	0.58
120_A	159_A	0.610	0.58
131_S	135_V	0.609	0.58
18_V	96_D	0.605	0.58
16_T	19_M	0.602	0.57
78_A	81_I	0.601	0.57
66_S	70_R	0.599	0.57
116_S	120_A	0.598	0.57
53_R	131_S	0.594	0.56
113_V	164_G	0.591	0.56
129_V	140_V	0.589	0.56
193_F	197_R	0.588	0.55
52_A	186_L	0.586	0.55
27_L	65_F	0.584	0.55
40_G	76_W	0.583	0.55
22_A	27_L	0.583	0.55
130_F	195_A	0.581	0.55
90_A	127_F	0.579	0.54
71_T	74_K	0.578	0.54
24_L	52_A	0.578	0.54
54_E	67_V	0.577	0.54
80_Q	140_V	0.572	0.53
47_A	172_H	0.571	0.53
144_S	182_S	0.571	0.53
128_P	185_S	0.570	0.53
41_L	83_G	0.568	0.53
97_M	149_F	0.566	0.53
159_A	164_G	0.566	0.53
158_M	188_L	0.566	0.53
43_P	62_A	0.564	0.52
25_N	180_S	0.564	0.52
94_F	107_V	0.563	0.52
102_Q	118_I	0.561	0.52
138_R	142_S	0.555	0.51
17_W	42_M	0.555	0.51
102_Q	175_F	0.554	0.51
127_F	155_T	0.554	0.51
123_V	127_F	0.552	0.51
129_V	135_V	0.549	0.50
51_V	71_T	0.548	0.50
118_I	127_F	0.547	0.50
39_F	160_A	0.546	0.50
46_A	71_T	0.545	0.50
22_A	174_T	0.543	0.50
161_G	175_F	0.543	0.50
165_V	184_L	0.539	0.49
68_F	71_T	0.539	0.49
15_C	165_V	0.538	0.49
52_A	56_A	0.538	0.49
106_P	141_L	0.538	0.49
111_V	114_S	0.536	0.49
151_R	154_V	0.536	0.49
157_L	160_A	0.534	0.49
153_A	194_K	0.531	0.48
197_R	200_D	0.530	0.48
99_I	142_S	0.529	0.48
100_A	169_V	0.527	0.48
194_K	197_R	0.527	0.48
88_T	197_R	0.526	0.48
111_V	177_L	0.525	0.47
111_V	147_I	0.524	0.47
30_L	184_L	0.524	0.47
24_L	103_M	0.523	0.47
30_L	198_S	0.523	0.47
84_L	93_L	0.522	0.47
185_S	196_F	0.521	0.47
141_L	145_F	0.520	0.47
42_M	132_H	0.519	0.47
57_K	133_F	0.516	0.46
164_G	173_V	0.516	0.46
136_K	140_V	0.516	0.46
17_W	55_W	0.515	0.46
59_N	63_P	0.514	0.46
100_A	112_F	0.513	0.46
15_C	19_M	0.513	0.46
39_F	77_R	0.512	0.46
107_V	176_L	0.510	0.46
97_M	109_V	0.509	0.45
18_V	179_F	0.507	0.45
151_R	192_S	0.506	0.45
122_V	155_T	0.505	0.45
75_E	78_A	0.505	0.45
15_C	24_L	0.504	0.45
92_F	124_L	0.503	0.45
95_A	183_L	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4djkA	2	0.8756	31.1	0.929	Contact Map
3w4tA	1	0.8995	27.6	0.931	Contact Map
3l1lA	2	0.8852	22.5	0.934	Contact Map
3b5xA	2	0.6938	14	0.94	Contact Map
3dh4A	3	0.8134	10.6	0.943	Contact Map
3tx3A	2	0.7225	10.4	0.943	Contact Map
4pl0A	2	0.7177	10.2	0.943	Contact Map
4k0jA	3	0.9139	10.1	0.943	Contact Map
4q4hA	1	0.6938	9.5	0.944	Contact Map
4h33A	3	0.4211	9.3	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.