YESJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YESJ - Uncharacterized N-acetyltransferase YesJ

UniProt:	O31513	Sequences: MTAFKIENETIADGFYACPAVYEDAESITGLLVRTAEWLRDRGSNQWSGLLKGQDIHDITGSIEKGHVFVFKKDEELAAVVMLLPAPSEWDRTLWGDDGHEESIYLHRLAVSRRFAGQGLGARVLQWAETGIHFPEKTRIRLDCVADSDALHSFYRRMGYEFMGADASGYHLFEKEITAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	180 (158)
Sequences:	2004 (1641)
Seq/√Len:	130.5

BACSU - YESJ YTMI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_C	72_K	4.373	1.00
129_E	175_K	2.904	1.00
26_E	56_I	2.656	1.00
81_V	124_V	2.605	1.00
142_L	155_Y	2.581	1.00
129_E	160_Y	2.528	1.00
139_R	174_E	2.525	1.00
78_A	115_F	2.495	1.00
68_V	80_V	2.480	1.00
122_A	157_R	2.337	1.00
18_C	24_D	2.324	1.00
20_A	28_I	2.322	1.00
76_E	114_R	2.259	1.00
162_F	171_H	2.257	1.00
62_S	108_R	2.222	1.00
20_A	68_V	2.150	1.00
104_I	132_I	2.116	1.00
56_I	60_T	1.983	1.00
27_S	30_G	1.942	1.00
31_L	110_A	1.890	1.00
156_R	162_F	1.857	1.00
81_V	128_A	1.820	1.00
153_S	156_R	1.798	1.00
60_T	64_E	1.795	1.00
19_P	66_G	1.791	1.00
34_R	112_S	1.773	1.00
22_Y	64_E	1.751	1.00
55_D	58_D	1.746	1.00
152_H	173_F	1.650	1.00
34_R	113_R	1.650	1.00
71_F	120_L	1.629	1.00
70_V	77_L	1.589	1.00
107_H	143_D	1.564	1.00
17_A	127_W	1.506	1.00
97_D	174_E	1.497	1.00
156_R	173_F	1.481	1.00
37_E	41_D	1.469	1.00
72_K	75_E	1.450	1.00
38_W	150_A	1.429	1.00
73_K	78_A	1.412	1.00
79_A	111_V	1.402	1.00
97_D	139_R	1.401	1.00
21_V	24_D	1.349	1.00
113_R	116_A	1.337	1.00
121_G	154_F	1.329	1.00
122_A	158_M	1.297	1.00
83_L	128_A	1.294	1.00
73_K	118_Q	1.284	1.00
85_P	104_I	1.258	1.00
80_V	110_A	1.253	1.00
111_V	120_L	1.251	1.00
32_L	80_V	1.244	1.00
96_G	174_E	1.244	1.00
18_C	70_V	1.223	1.00
61_G	65_K	1.221	1.00
151_L	155_Y	1.217	1.00
152_H	171_H	1.205	0.99
73_K	115_F	1.202	0.99
152_H	162_F	1.189	0.99
149_D	152_H	1.181	0.99
127_W	130_T	1.179	0.99
71_F	79_A	1.150	0.99
87_P	92_R	1.146	0.99
62_S	82_M	1.129	0.99
25_A	63_I	1.104	0.99
22_Y	60_T	1.103	0.99
69_F	131_G	1.100	0.99
30_G	34_R	1.097	0.99
131_G	134_F	1.092	0.99
109_L	124_V	1.092	0.99
33_V	36_A	1.088	0.99
109_L	121_G	1.085	0.99
38_W	42_R	1.081	0.99
130_T	134_F	1.075	0.99
15_F	73_K	1.072	0.99
153_S	157_R	1.071	0.99
29_T	56_I	1.033	0.98
19_P	69_F	1.015	0.98
144_C	151_L	1.005	0.98
123_R	126_Q	0.984	0.98
38_W	116_A	0.964	0.97
146_A	169_G	0.962	0.97
61_G	64_E	0.961	0.97
125_L	158_M	0.960	0.97
127_W	131_G	0.959	0.97
115_F	118_Q	0.940	0.97
90_W	168_S	0.925	0.97
67_H	84_L	0.921	0.97
129_E	140_I	0.919	0.97
28_I	32_L	0.919	0.97
16_Y	72_K	0.917	0.97
96_G	139_R	0.914	0.97
119_G	122_A	0.912	0.96
43_G	46_Q	0.909	0.96
39_L	48_S	0.909	0.96
71_F	124_V	0.901	0.96
152_H	156_R	0.897	0.96
95_W	107_H	0.893	0.96
106_L	125_L	0.887	0.96
123_R	127_W	0.862	0.95
91_D	107_H	0.857	0.95
39_L	46_Q	0.854	0.95
29_T	59_I	0.844	0.95
94_L	163_M	0.842	0.94
24_D	27_S	0.840	0.94
32_L	59_I	0.824	0.94
34_R	114_R	0.824	0.94
102_E	138_T	0.823	0.94
107_H	148_S	0.822	0.94
89_E	92_R	0.818	0.94
131_G	135_P	0.817	0.94
46_Q	108_R	0.811	0.93
97_D	176_E	0.809	0.93
57_H	60_T	0.809	0.93
112_S	115_F	0.809	0.93
78_A	112_S	0.802	0.93
105_Y	155_Y	0.802	0.93
52_K	148_S	0.792	0.92
124_V	128_A	0.785	0.92
27_S	77_L	0.777	0.92
59_I	68_V	0.771	0.91
126_Q	158_M	0.766	0.91
24_D	72_K	0.765	0.91
67_H	82_M	0.754	0.91
20_A	70_V	0.753	0.90
95_W	141_R	0.751	0.90
90_W	166_D	0.751	0.90
28_I	80_V	0.749	0.90
83_L	131_G	0.749	0.90
47_W	110_A	0.745	0.90
84_L	105_Y	0.743	0.90
94_L	172_L	0.742	0.90
40_R	45_N	0.741	0.90
44_S	145_V	0.740	0.90
76_E	112_S	0.738	0.90
61_G	136_E	0.735	0.89
122_A	126_Q	0.735	0.89
108_R	148_S	0.731	0.89
144_C	152_H	0.728	0.89
160_Y	175_K	0.726	0.89
35_T	110_A	0.726	0.89
47_W	143_D	0.721	0.89
38_W	113_R	0.720	0.88
39_L	44_S	0.716	0.88
46_Q	143_D	0.714	0.88
150_A	153_S	0.711	0.88
31_L	70_V	0.709	0.88
68_V	82_M	0.704	0.87
105_Y	151_L	0.701	0.87
63_I	68_V	0.700	0.87
39_L	42_R	0.698	0.87
62_S	68_V	0.698	0.87
83_L	104_I	0.696	0.87
132_I	140_I	0.691	0.86
59_I	80_V	0.684	0.86
145_V	170_Y	0.684	0.86
29_T	33_V	0.682	0.86
81_V	127_W	0.680	0.85
46_Q	148_S	0.674	0.85
103_S	139_R	0.673	0.85
162_F	165_A	0.667	0.84
150_A	154_F	0.664	0.84
78_A	120_L	0.658	0.84
25_A	60_T	0.652	0.83
27_S	112_S	0.650	0.83
125_L	154_F	0.649	0.83
140_I	160_Y	0.648	0.83
103_S	151_L	0.648	0.83
139_R	176_E	0.646	0.82
44_S	48_S	0.633	0.81
129_E	158_M	0.633	0.81
142_L	151_L	0.632	0.81
35_T	113_R	0.630	0.81
117_G	121_G	0.624	0.80
56_I	59_I	0.624	0.80
91_D	143_D	0.621	0.80
165_A	169_G	0.620	0.80
50_L	55_D	0.616	0.79
25_A	59_I	0.615	0.79
30_G	37_E	0.615	0.79
96_G	163_M	0.615	0.79
87_P	104_I	0.615	0.79
72_K	77_L	0.613	0.79
51_L	62_S	0.613	0.79
115_F	120_L	0.612	0.79
109_L	151_L	0.610	0.79
93_T	167_A	0.606	0.78
47_W	141_R	0.602	0.78
17_A	81_V	0.601	0.78
84_L	107_H	0.599	0.77
25_A	56_I	0.598	0.77
149_D	153_S	0.596	0.77
63_I	148_S	0.593	0.77
32_L	110_A	0.593	0.77
15_F	71_F	0.591	0.76
82_M	108_R	0.588	0.76
145_V	151_L	0.587	0.76
73_K	123_R	0.586	0.76
88_S	105_Y	0.585	0.76
82_M	86_A	0.583	0.76
45_N	48_S	0.580	0.75
85_P	130_T	0.580	0.75
146_A	171_H	0.578	0.75
107_H	141_R	0.576	0.75
35_T	108_R	0.575	0.75
45_N	145_V	0.574	0.74
91_D	103_S	0.567	0.74
96_G	161_E	0.565	0.73
125_L	129_E	0.554	0.72
40_R	49_G	0.553	0.72
81_V	106_L	0.553	0.72
20_A	24_D	0.551	0.71
79_A	124_V	0.545	0.71
165_A	171_H	0.545	0.71
37_E	40_R	0.538	0.70
69_F	127_W	0.536	0.69
134_F	138_T	0.536	0.69
64_E	130_T	0.536	0.69
95_W	148_S	0.535	0.69
51_L	91_D	0.533	0.69
46_Q	151_L	0.532	0.69
121_G	125_L	0.529	0.68
42_R	150_A	0.526	0.68
27_S	31_L	0.526	0.68
106_L	142_L	0.524	0.68
21_V	75_E	0.522	0.67
146_A	165_A	0.519	0.67
162_F	173_F	0.518	0.67
39_L	51_L	0.516	0.66
126_Q	176_E	0.514	0.66
65_K	115_F	0.513	0.66
138_T	176_E	0.510	0.66
72_K	78_A	0.510	0.66
32_L	68_V	0.508	0.65
28_I	59_I	0.508	0.65
104_I	140_I	0.506	0.65
36_A	46_Q	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2oh1A	1	0.9722	100	0.364	Contact Map
2pc1A	1	0.9167	100	0.442	Contact Map
2fiaA	1	0.8444	99.9	0.457	Contact Map
3h4qA	1	0.7944	99.9	0.467	Contact Map
3dr6A	2	0.8444	99.9	0.517	Contact Map
2j8mA	2	0.8444	99.9	0.54	Contact Map
1s3zA	2	0.8056	99.9	0.541	Contact Map
3zj0A	1	0.8889	99.9	0.543	Contact Map
3fixA	2	0.8556	99.9	0.545	Contact Map
3fynA	2	0.8111	99.9	0.547	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.