YESE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YESE - Uncharacterized protein YesE

UniProt:	O31511	Sequences: MLMNEFEKACETLRKFMAYMLEKDMKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDYIKDYPKQIHLSSFTAPTVYRSADSNTVIAEFQCDGHVIETGLPYRQSYISVIETRDGRIVRYRDYWNPLVVKEAFGGSFLQTEESGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (130)
Sequences:	533 (412)
Seq/√Len:	36.1

BACSU - YESE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_D	27_S	3.431	1.00
32_W	36_A	3.221	1.00
36_A	57_I	3.085	1.00
52_E	56_A	2.971	1.00
12_T	114_T	2.938	1.00
90_E	123_R	2.850	1.00
75_A	92_Q	2.780	1.00
94_D	105_R	2.602	1.00
115_R	120_V	2.577	1.00
33_D	120_V	2.400	1.00
10_C	80_R	2.235	0.99
10_C	14_R	2.217	0.99
39_E	50_R	2.216	0.99
81_S	84_S	2.104	0.99
92_Q	107_S	2.047	0.99
85_N	115_R	2.015	0.98
26_K	58_Y	1.979	0.98
34_E	118_R	1.959	0.98
55_A	58_Y	1.867	0.97
44_P	128_P	1.854	0.97
113_E	121_R	1.836	0.97
39_E	121_R	1.809	0.97
35_N	53_G	1.719	0.96
42_Y	106_Q	1.608	0.94
8_K	11_E	1.600	0.94
91_F	122_Y	1.592	0.94
40_F	126_W	1.561	0.93
25_M	61_I	1.480	0.91
44_P	127_N	1.478	0.91
13_L	87_V	1.457	0.90
37_V	121_R	1.413	0.89
40_F	122_Y	1.380	0.88
37_V	50_R	1.366	0.87
54_K	62_K	1.362	0.87
83_D	113_E	1.344	0.86
32_W	57_I	1.335	0.86
28_W	61_I	1.332	0.86
88_I	111_V	1.324	0.85
13_L	112_I	1.318	0.85
9_A	87_V	1.314	0.85
15_K	18_A	1.303	0.85
54_K	118_R	1.288	0.84
55_A	59_D	1.245	0.82
9_A	114_T	1.219	0.80
110_S	122_Y	1.203	0.79
81_S	86_T	1.188	0.79
95_G	104_Y	1.187	0.78
91_F	110_S	1.174	0.78
28_W	124_D	1.146	0.76
32_W	122_Y	1.124	0.75
97_V	100_T	1.096	0.73
109_I	129_L	1.086	0.72
13_L	89_A	1.068	0.71
32_W	87_V	1.065	0.70
74_T	94_D	1.058	0.70
30_E	98_I	1.046	0.69
37_V	53_G	1.040	0.69
108_Y	126_W	1.036	0.68
73_F	93_C	1.030	0.68
66_K	69_H	1.027	0.68
111_V	124_D	1.019	0.67
61_I	67_Q	1.015	0.67
16_F	28_W	0.962	0.62
88_I	124_D	0.952	0.62
18_A	22_E	0.948	0.61
127_N	130_V	0.943	0.61
30_E	134_A	0.925	0.59
20_M	28_W	0.913	0.58
16_F	61_I	0.912	0.58
43_A	51_I	0.900	0.57
29_T	54_K	0.889	0.56
74_T	96_H	0.883	0.56
28_W	112_I	0.877	0.55
53_G	56_A	0.877	0.55
61_I	93_C	0.866	0.54
29_T	36_A	0.861	0.54
93_C	128_P	0.860	0.54
104_Y	124_D	0.850	0.53
51_I	60_Y	0.848	0.53
104_Y	107_S	0.846	0.53
31_L	103_P	0.846	0.53
122_Y	126_W	0.845	0.53
18_A	116_D	0.838	0.52
29_T	58_Y	0.835	0.52
95_G	135_F	0.831	0.51
86_T	113_E	0.828	0.51
79_Y	82_A	0.827	0.51
36_A	52_E	0.826	0.51
33_D	123_R	0.813	0.50
28_W	107_S	0.812	0.50
38_F	110_S	0.810	0.49
93_C	108_Y	0.808	0.49
10_C	78_V	0.805	0.49
25_M	29_T	0.798	0.48
49_K	109_I	0.792	0.48
110_S	124_D	0.791	0.48
122_Y	127_N	0.791	0.48
24_D	57_I	0.787	0.47
109_I	125_Y	0.785	0.47
12_T	37_V	0.780	0.47
91_F	108_Y	0.780	0.47
43_A	126_W	0.772	0.46
11_E	22_E	0.772	0.46
54_K	81_S	0.765	0.46
19_Y	27_S	0.763	0.45
79_Y	111_V	0.763	0.45
37_V	78_V	0.759	0.45
14_R	78_V	0.755	0.45
93_C	106_Q	0.752	0.44
32_W	99_E	0.736	0.43
95_G	109_I	0.732	0.43
60_Y	128_P	0.730	0.43
114_T	127_N	0.719	0.42
15_K	19_Y	0.718	0.42
83_D	99_E	0.717	0.41
69_H	96_H	0.714	0.41
10_C	135_F	0.711	0.41
34_E	120_V	0.709	0.41
85_N	101_G	0.691	0.39
113_E	120_V	0.687	0.39
19_Y	38_F	0.685	0.39
85_N	120_V	0.683	0.39
65_P	88_I	0.682	0.39
12_T	77_T	0.676	0.38
51_I	108_Y	0.675	0.38
20_M	124_D	0.666	0.37
93_C	124_D	0.664	0.37
64_Y	86_T	0.659	0.37
15_K	45_E	0.657	0.36
14_R	18_A	0.656	0.36
83_D	115_R	0.654	0.36
15_K	33_D	0.651	0.36
29_T	87_V	0.642	0.35
60_Y	91_F	0.641	0.35
61_I	127_N	0.641	0.35
40_F	112_I	0.636	0.35
105_R	130_V	0.633	0.35
9_A	85_N	0.632	0.34
60_Y	122_Y	0.631	0.34
10_C	57_I	0.631	0.34
23_K	27_S	0.628	0.34
28_W	122_Y	0.626	0.34
25_M	63_D	0.624	0.34
91_F	109_I	0.620	0.34
63_D	105_R	0.615	0.33
115_R	118_R	0.614	0.33
64_Y	69_H	0.614	0.33
31_L	84_S	0.611	0.33
28_W	117_G	0.610	0.33
65_P	108_Y	0.608	0.33
78_V	94_D	0.607	0.33
124_D	135_F	0.602	0.32
26_K	85_N	0.599	0.32
85_N	114_T	0.599	0.32
45_E	83_D	0.595	0.32
38_F	93_C	0.595	0.32
57_I	124_D	0.593	0.31
30_E	82_A	0.593	0.31
92_Q	135_F	0.592	0.31
31_L	98_I	0.586	0.31
109_I	134_A	0.584	0.31
72_S	94_D	0.582	0.31
51_I	56_A	0.576	0.30
59_D	62_K	0.571	0.30
58_Y	125_Y	0.570	0.30
83_D	86_T	0.569	0.30
25_M	108_Y	0.568	0.30
28_W	68_I	0.566	0.29
52_E	137_G	0.562	0.29
56_A	103_P	0.561	0.29
33_D	54_K	0.561	0.29
37_V	45_E	0.561	0.29
78_V	117_G	0.556	0.29
19_Y	28_W	0.553	0.29
87_V	98_I	0.553	0.29
26_K	136_G	0.551	0.28
100_T	112_I	0.550	0.28
106_Q	134_A	0.549	0.28
66_K	116_D	0.545	0.28
30_E	55_A	0.543	0.28
38_F	61_I	0.539	0.28
35_N	117_G	0.534	0.27
21_L	94_D	0.532	0.27
89_A	101_G	0.531	0.27
10_C	118_R	0.530	0.27
9_A	106_Q	0.525	0.27
50_R	115_R	0.523	0.26
60_Y	126_W	0.522	0.26
33_D	38_F	0.521	0.26
8_K	12_T	0.516	0.26
58_Y	62_K	0.510	0.26
106_Q	124_D	0.510	0.26
56_A	59_D	0.505	0.25
51_I	125_Y	0.503	0.25
130_V	137_G	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1s5aA	4	0.966	99.9	0.485	Contact Map
3jumA	2	0.9456	99.9	0.531	Contact Map
3ff0A	2	0.9728	99.9	0.537	Contact Map
1z1sA	1	0.9116	99.9	0.542	Contact Map
3fgyA	2	0.9184	99.8	0.575	Contact Map
3dm8A	2	0.9048	99.8	0.586	Contact Map
3grdA	2	0.898	99.8	0.589	Contact Map
3ebtA	2	0.8776	99.8	0.592	Contact Map
4r9kA	2	0.9048	99.8	0.597	Contact Map
3i0yA	2	0.8844	99.8	0.599	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.