YCZC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YCZC - Uncharacterized protein YczC

UniProt:	O31469	Sequences: MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILMLIVYPLLMPLTNWKGTLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLTAAFTKKKQTVHDMAAKTIVLKAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (121)
Sequences:	2134 (1677)
Seq/√Len:	152.4

BACSU - YCZC YCKC YTEJ YXAI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_M	62_L	4.100	1.00
108_T	117_M	3.483	1.00
112_Q	117_M	3.417	1.00
8_L	125_K	3.249	1.00
105_A	113_T	3.017	1.00
15_L	67_I	2.648	1.00
73_R	84_Q	2.479	1.00
80_I	85_A	2.476	1.00
75_E	78_K	2.432	1.00
104_T	114_V	2.312	1.00
4_A	69_L	2.297	1.00
103_L	107_F	2.064	1.00
91_I	118_A	2.046	1.00
60_G	65_K	2.017	1.00
80_I	121_T	1.833	1.00
108_T	112_Q	1.772	1.00
95_H	101_I	1.717	1.00
11_C	67_I	1.658	1.00
74_D	112_Q	1.604	1.00
55_L	82_F	1.604	1.00
54_P	89_Y	1.508	1.00
72_V	124_L	1.496	1.00
110_K	122_I	1.458	1.00
95_H	115_H	1.456	1.00
97_F	114_V	1.430	1.00
98_S	101_I	1.413	1.00
15_L	66_I	1.406	1.00
72_V	122_I	1.402	1.00
104_T	108_T	1.401	1.00
73_R	78_K	1.392	1.00
5_G	8_L	1.377	1.00
29_F	33_D	1.376	1.00
6_F	105_A	1.362	1.00
13_L	50_P	1.296	1.00
18_I	22_A	1.286	1.00
92_A	95_H	1.277	1.00
47_I	86_I	1.260	1.00
100_L	103_L	1.251	1.00
74_D	122_I	1.221	1.00
51_L	85_A	1.186	1.00
52_L	57_N	1.186	1.00
49_Y	54_P	1.176	1.00
21_A	25_L	1.172	1.00
55_L	85_A	1.171	1.00
103_L	106_A	1.128	1.00
50_P	61_T	1.111	0.99
59_K	70_Q	1.104	0.99
87_V	90_L	1.103	0.99
74_D	110_K	1.100	0.99
14_L	18_I	1.095	0.99
73_R	81_S	1.085	0.99
58_W	65_K	1.084	0.99
87_V	118_A	1.080	0.99
54_P	71_I	1.052	0.99
95_H	113_T	1.041	0.99
83_P	87_V	1.031	0.99
112_Q	122_I	0.994	0.99
12_A	64_K	0.994	0.99
97_F	100_L	0.992	0.99
49_Y	55_L	0.987	0.99
8_L	69_L	0.977	0.99
81_S	84_Q	0.976	0.99
13_L	17_V	0.962	0.98
101_I	114_V	0.958	0.98
10_A	105_A	0.953	0.98
35_S	38_V	0.949	0.98
46_L	50_P	0.949	0.98
51_L	86_I	0.932	0.98
6_F	106_A	0.927	0.98
10_A	13_L	0.926	0.98
49_Y	114_V	0.926	0.98
97_F	101_I	0.924	0.98
3_L	6_F	0.922	0.98
30_T	33_D	0.918	0.98
54_P	64_K	0.915	0.98
50_P	54_P	0.907	0.98
54_P	115_H	0.890	0.97
53_M	65_K	0.879	0.97
15_L	19_I	0.866	0.97
8_L	67_I	0.859	0.97
85_A	89_Y	0.858	0.97
95_H	102_Y	0.852	0.97
18_I	21_A	0.849	0.97
93_W	96_V	0.848	0.97
28_G	32_G	0.840	0.96
111_K	118_A	0.837	0.96
8_L	11_C	0.826	0.96
71_I	85_A	0.821	0.96
5_G	106_A	0.813	0.96
54_P	113_T	0.811	0.96
47_I	51_L	0.803	0.95
38_V	42_A	0.792	0.95
7_M	106_A	0.787	0.95
64_K	123_V	0.786	0.95
60_G	69_L	0.782	0.95
100_L	104_T	0.782	0.95
48_V	52_L	0.779	0.95
53_M	57_N	0.772	0.94
32_G	38_V	0.765	0.94
3_L	122_I	0.764	0.94
91_I	115_H	0.760	0.94
16_D	63_G	0.759	0.94
6_F	102_Y	0.756	0.94
59_K	72_V	0.753	0.94
23_V	45_M	0.747	0.93
73_R	80_I	0.738	0.93
74_D	120_K	0.738	0.93
73_R	120_K	0.738	0.93
37_G	41_V	0.734	0.93
84_Q	87_V	0.731	0.92
39_I	42_A	0.731	0.92
51_L	55_L	0.729	0.92
51_L	82_F	0.725	0.92
5_G	105_A	0.725	0.92
33_D	47_I	0.723	0.92
26_A	30_T	0.713	0.92
104_T	117_M	0.712	0.91
90_L	95_H	0.700	0.91
62_L	66_I	0.696	0.91
57_N	65_K	0.694	0.90
101_I	105_A	0.684	0.90
64_K	71_I	0.676	0.89
115_H	119_A	0.665	0.88
89_Y	92_A	0.660	0.88
8_L	111_K	0.658	0.88
47_I	89_Y	0.655	0.88
28_G	93_W	0.650	0.87
54_P	92_A	0.649	0.87
7_M	11_C	0.646	0.87
29_F	34_G	0.642	0.87
12_A	69_L	0.639	0.86
30_T	37_G	0.638	0.86
12_A	67_I	0.633	0.86
48_V	82_F	0.632	0.86
92_A	102_Y	0.627	0.85
3_L	111_K	0.618	0.85
49_Y	62_L	0.611	0.84
110_K	117_M	0.592	0.82
91_I	95_H	0.585	0.81
60_G	85_A	0.584	0.81
19_I	66_I	0.584	0.81
5_G	111_K	0.583	0.81
51_L	90_L	0.583	0.81
86_I	90_L	0.581	0.81
6_F	115_H	0.579	0.81
22_A	66_I	0.576	0.80
34_G	42_A	0.574	0.80
83_P	118_A	0.573	0.80
49_Y	52_L	0.572	0.80
72_V	79_K	0.572	0.80
105_A	111_K	0.571	0.80
96_V	102_Y	0.567	0.79
7_M	14_L	0.566	0.79
19_I	23_V	0.566	0.79
59_K	79_K	0.561	0.78
20_A	38_V	0.560	0.78
71_I	80_I	0.557	0.78
21_A	33_D	0.554	0.78
99_R	102_Y	0.551	0.77
31_F	109_K	0.547	0.77
29_F	42_A	0.546	0.77
99_R	103_L	0.541	0.76
40_I	44_L	0.540	0.76
114_V	119_A	0.537	0.75
15_L	64_K	0.536	0.75
68_G	125_K	0.535	0.75
4_A	8_L	0.533	0.75
39_I	43_I	0.532	0.75
22_A	29_F	0.529	0.74
23_V	102_Y	0.526	0.74
122_I	125_K	0.524	0.74
69_L	123_V	0.513	0.72
40_I	47_I	0.507	0.71
36_A	44_L	0.505	0.71
51_L	61_T	0.505	0.71
105_A	123_V	0.504	0.71
17_V	100_L	0.504	0.71
43_I	90_L	0.504	0.71
95_H	114_V	0.503	0.71
25_L	107_F	0.501	0.70
21_A	35_S	0.500	0.70
101_I	104_T	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bivA	1	0.1732	3.8	0.943	Contact Map
1lm5A	2	0.5197	3.4	0.945	Contact Map
4mudA	2	0.4646	3.2	0.946	Contact Map
3j3wE	1	0.378	3.1	0.946	Contact Map
3cniA	2	0.3937	2.9	0.947	Contact Map
4hdeA	1	0.5512	2.1	0.95	Contact Map
4pirA	3	0.3071	2.1	0.95	Contact Map
4tr3A	1	0.6378	2	0.951	Contact Map
4q28A	1	0.5669	2	0.951	Contact Map
2a4vA	1	0.5512	2	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.