TATAD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TATAD - Sec-independent protein translocase protein TatAd

UniProt:	O31467	Sequences: MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATKSLVSGDEKEEKSAELTAVKQDKNAG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	70 (60)
Sequences:	419 (335)
Seq/√Len:	43.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_A	38_L	2.700	1.00
35_R	38_L	2.421	1.00
29_I	36_T	2.295	1.00
56_K	59_E	1.975	0.99
35_R	43_A	1.746	0.98
17_A	20_I	1.672	0.97
17_A	31_R	1.622	0.97
32_A	36_T	1.583	0.96
4_N	7_I	1.513	0.95
4_N	31_R	1.436	0.93
16_I	19_I	1.427	0.93
9_G	37_L	1.421	0.93
46_S	49_S	1.356	0.91
10_L	14_F	1.337	0.91
31_R	38_L	1.300	0.89
36_T	43_A	1.267	0.88
51_D	54_E	1.263	0.88
45_K	49_S	1.263	0.88
55_E	60_L	1.262	0.88
5_I	9_G	1.261	0.88
9_G	20_I	1.255	0.88
51_D	58_A	1.237	0.87
20_I	36_T	1.235	0.87
8_P	29_I	1.234	0.87
29_I	33_A	1.216	0.86
43_A	46_S	1.183	0.84
3_S	24_S	1.174	0.84
42_S	45_K	1.161	0.83
7_I	14_F	1.158	0.83
52_E	56_K	1.132	0.82
51_D	55_E	1.131	0.82
24_S	48_V	1.095	0.79
24_S	33_A	1.082	0.79
51_D	59_E	1.072	0.78
11_I	15_V	1.070	0.78
13_I	20_I	1.049	0.76
15_V	19_I	1.043	0.76
24_S	47_L	1.031	0.75
54_E	57_S	1.024	0.75
49_S	58_A	0.989	0.72
33_A	37_L	0.980	0.71
53_K	56_K	0.961	0.70
52_E	59_E	0.929	0.67
24_S	31_R	0.929	0.67
32_A	41_K	0.896	0.64
16_I	61_T	0.892	0.64
19_I	29_I	0.889	0.64
55_E	58_A	0.848	0.60
28_E	35_R	0.847	0.60
32_A	47_L	0.826	0.58
56_K	60_L	0.823	0.58
20_I	29_I	0.819	0.57
57_S	60_L	0.808	0.56
4_N	33_A	0.806	0.56
31_R	35_R	0.782	0.54
5_I	10_L	0.779	0.54
12_L	17_A	0.757	0.51
46_S	50_G	0.743	0.50
8_P	11_I	0.731	0.49
57_S	61_T	0.713	0.47
58_A	61_T	0.705	0.46
48_V	51_D	0.694	0.45
42_S	60_L	0.694	0.45
54_E	61_T	0.692	0.45
12_L	31_R	0.689	0.45
16_I	52_E	0.686	0.45
12_L	19_I	0.684	0.45
53_K	61_T	0.680	0.44
29_I	38_L	0.667	0.43
3_S	41_K	0.655	0.42
35_R	44_T	0.647	0.41
25_K	32_A	0.646	0.41
10_L	13_I	0.645	0.41
8_P	16_I	0.645	0.41
13_I	24_S	0.639	0.40
41_K	47_L	0.626	0.39
24_S	43_A	0.602	0.37
12_L	28_E	0.602	0.37
33_A	36_T	0.587	0.36
20_I	35_R	0.583	0.35
2_F	57_S	0.583	0.35
47_L	53_K	0.581	0.35
2_F	41_K	0.575	0.35
49_S	60_L	0.570	0.34
5_I	15_V	0.568	0.34
54_E	58_A	0.555	0.33
19_I	49_S	0.524	0.30
49_S	52_E	0.518	0.30
4_N	13_I	0.511	0.29
24_S	28_E	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l16A	1	0.7429	99.8	0.336	Contact Map
2mn6B	2	0.6571	99.7	0.411	Contact Map
2mi2A	1	0.9857	99.6	0.446	Contact Map
2lzrA	1	0.7	99.5	0.481	Contact Map
1wgxA	1	0.8429	9.4	0.913	Contact Map
5a2fA	1	0	9.3	0.913	Contact Map
2c9kA	1	0.8571	5.7	0.921	Contact Map
4pypA	1	0.3571	5.2	0.922	Contact Map
2jlnA	1	0.5857	5.1	0.923	Contact Map
3gjxA	1	0.8571	4.9	0.923	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.