GAMA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GAMA - Probable glucosamine-6-phosphate deaminase 2

UniProt:	O31458	Sequences: MKILIAEHYEELCKLSAAIIKEQIQAKKDAVLGLATGSTPVGLYKQLISDYQAGEIDFSKVTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPDHIHIPQGDNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQANARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPASILQKHNHVTVIADYKAAQKLKSASFS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	249 (223)
Sequences:	5215 (3803)
Seq/√Len:	254.6

ECOLI - NAGB AGAI YIEK
BACSU - GAMA NAGB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_H	86_E	3.648	1.00
202_E	238_K	2.852	1.00
7_E	237_Y	2.800	1.00
135_A	203_E	2.683	1.00
112_A	115_V	2.660	1.00
194_H	230_H	2.626	1.00
46_Q	49_S	2.555	1.00
8_H	11_E	2.447	1.00
208_I	235_A	2.445	1.00
85_H	90_Q	2.316	1.00
102_P	181_I	2.221	1.00
118_D	122_Q	2.160	1.00
57_D	93_N	2.139	1.00
23_Q	30_A	2.136	1.00
206_D	210_K	2.124	1.00
235_A	240_A	2.124	1.00
13_C	42_G	2.061	1.00
172_D	175_L	1.993	1.00
62_T	100_H	1.986	1.00
6_A	15_L	1.981	1.00
74_P	81_N	1.961	1.00
127_D	193_K	1.960	1.00
23_Q	194_H	1.954	1.00
86_E	90_Q	1.936	1.00
12_L	200_S	1.891	1.00
129_Q	192_S	1.882	1.00
20_I	43_L	1.828	1.00
100_H	119_L	1.818	1.00
14_K	46_Q	1.818	1.00
63_T	89_F	1.813	1.00
209_Q	213_E	1.764	1.00
81_N	85_H	1.760	1.00
108_Q	111_A	1.758	1.00
41_V	87_H	1.758	1.00
29_D	62_T	1.708	1.00
210_K	220_V	1.683	1.00
159_E	163_Q	1.657	1.00
70_A	109_L	1.656	1.00
189_M	224_I	1.650	1.00
9_Y	13_C	1.639	1.00
21_K	56_I	1.607	1.00
39_T	198_L	1.601	1.00
81_N	101_I	1.587	1.00
62_T	98_H	1.577	1.00
133_I	199_A	1.553	1.00
48_I	91_H	1.551	1.00
114_K	118_D	1.535	1.00
111_A	115_V	1.527	1.00
85_H	96_P	1.521	1.00
43_L	130_I	1.514	1.00
202_E	241_Q	1.476	1.00
24_I	61_V	1.458	1.00
20_I	32_L	1.457	1.00
45_K	87_H	1.448	1.00
199_A	208_I	1.446	1.00
5_I	240_A	1.440	1.00
106_N	112_A	1.422	1.00
19_I	234_I	1.421	1.00
207_A	220_V	1.416	1.00
115_V	119_L	1.379	1.00
7_E	11_E	1.373	1.00
33_G	129_Q	1.365	1.00
35_A	66_L	1.350	1.00
135_A	164_A	1.342	1.00
49_S	53_A	1.326	1.00
133_I	211_M	1.307	1.00
59_S	93_N	1.306	1.00
75_S	82_H	1.304	1.00
128_V	196_V	1.293	1.00
137_G	220_V	1.292	1.00
211_M	222_A	1.289	1.00
183_M	187_T	1.275	1.00
95_Q	98_H	1.270	1.00
15_L	18_A	1.249	1.00
33_G	66_L	1.228	1.00
43_L	198_L	1.226	1.00
6_A	234_I	1.225	1.00
16_S	43_L	1.222	1.00
211_M	233_V	1.216	1.00
20_I	128_V	1.206	1.00
16_S	196_V	1.205	1.00
205_A	241_Q	1.204	1.00
117_E	187_T	1.203	1.00
77_P	82_H	1.202	1.00
133_I	222_A	1.202	1.00
24_I	30_A	1.200	1.00
31_V	64_F	1.191	1.00
118_D	121_R	1.187	1.00
65_N	84_M	1.186	1.00
9_Y	42_G	1.185	1.00
140_G	188_I	1.158	1.00
194_H	232_T	1.157	1.00
115_V	118_D	1.157	1.00
19_I	194_H	1.157	1.00
42_G	45_K	1.152	1.00
10_E	42_G	1.144	1.00
64_F	123_A	1.143	1.00
31_V	62_T	1.137	1.00
227_K	231_V	1.133	1.00
79_S	82_H	1.132	1.00
6_A	12_L	1.132	1.00
119_L	122_Q	1.129	1.00
121_R	190_E	1.122	1.00
160_S	164_A	1.117	1.00
6_A	11_E	1.101	1.00
16_S	234_I	1.098	1.00
28_K	60_K	1.098	1.00
94_M	98_H	1.069	1.00
58_F	61_V	1.069	1.00
27_K	127_D	1.057	1.00
170_G	175_L	1.054	1.00
18_A	22_E	1.045	1.00
148_F	224_I	1.043	1.00
5_I	237_Y	1.036	1.00
73_S	105_D	1.034	1.00
38_S	168_F	1.027	1.00
41_V	83_F	1.024	1.00
170_G	173_P	1.023	1.00
83_F	87_H	1.006	1.00
19_I	196_V	1.004	1.00
41_V	45_K	1.004	1.00
33_G	126_I	1.002	1.00
205_A	209_Q	1.000	1.00
207_A	210_K	0.988	1.00
62_T	95_Q	0.984	1.00
57_D	60_K	0.978	1.00
45_K	91_H	0.975	1.00
186_K	190_E	0.972	1.00
27_K	193_K	0.968	1.00
12_L	234_I	0.964	1.00
113_C	117_E	0.963	1.00
110_E	114_K	0.963	1.00
85_H	99_I	0.962	1.00
30_A	61_V	0.960	1.00
89_F	99_I	0.959	1.00
173_P	176_V	0.957	1.00
111_A	114_K	0.954	1.00
4_L	15_L	0.954	1.00
11_E	14_K	0.950	1.00
106_N	109_L	0.948	1.00
4_L	232_T	0.946	1.00
13_C	43_L	0.940	1.00
9_Y	200_S	0.937	1.00
30_A	128_V	0.931	1.00
103_Q	112_A	0.914	1.00
85_H	101_I	0.913	1.00
95_Q	99_I	0.912	1.00
4_L	234_I	0.900	1.00
120_I	126_I	0.899	1.00
210_K	219_D	0.894	1.00
185_I	224_I	0.894	1.00
19_I	23_Q	0.892	1.00
10_E	46_Q	0.888	1.00
159_E	162_I	0.883	1.00
34_L	63_T	0.877	1.00
109_L	181_I	0.876	1.00
165_N	168_F	0.875	1.00
192_S	195_I	0.875	1.00
173_P	178_R	0.873	1.00
208_I	233_V	0.870	1.00
27_K	30_A	0.864	1.00
208_I	211_M	0.858	0.99
35_A	129_Q	0.856	0.99
197_L	222_A	0.848	0.99
215_P	223_S	0.844	0.99
42_G	46_Q	0.842	0.99
58_F	92_I	0.837	0.99
34_L	44_Y	0.835	0.99
133_I	208_I	0.833	0.99
18_A	55_E	0.828	0.99
216_V	227_K	0.822	0.99
67_D	138_H	0.820	0.99
56_I	61_V	0.816	0.99
220_V	223_S	0.812	0.99
64_F	119_L	0.807	0.99
189_M	228_H	0.805	0.99
39_T	200_S	0.804	0.99
66_L	183_M	0.801	0.99
40_P	44_Y	0.791	0.99
73_S	76_H	0.790	0.99
20_I	130_I	0.788	0.99
210_K	214_G	0.788	0.99
188_I	195_I	0.787	0.99
125_G	193_K	0.785	0.99
103_Q	106_N	0.785	0.99
84_M	89_F	0.785	0.99
195_I	231_V	0.783	0.99
69_Y	180_A	0.782	0.99
74_P	85_H	0.778	0.99
69_Y	80_Y	0.777	0.99
211_M	220_V	0.770	0.99
10_E	14_K	0.764	0.99
174_V	178_R	0.763	0.99
62_T	123_A	0.761	0.99
35_A	139_I	0.755	0.99
64_F	100_H	0.755	0.99
126_I	129_Q	0.753	0.99
66_L	188_I	0.750	0.99
117_E	121_R	0.744	0.99
235_A	239_A	0.733	0.98
59_S	95_Q	0.733	0.98
45_K	49_S	0.733	0.98
9_Y	12_L	0.731	0.98
205_A	240_A	0.731	0.98
161_T	165_N	0.730	0.98
189_M	227_K	0.730	0.98
16_S	20_I	0.729	0.98
109_L	179_L	0.727	0.98
16_S	198_L	0.726	0.98
130_I	198_L	0.721	0.98
189_M	225_L	0.716	0.98
78_Q	178_R	0.715	0.98
135_A	207_A	0.715	0.98
161_T	164_A	0.710	0.98
139_I	197_L	0.706	0.98
17_A	47_L	0.703	0.98
80_Y	180_A	0.698	0.98
5_I	235_A	0.695	0.98
10_E	45_K	0.694	0.98
74_P	101_I	0.694	0.98
14_K	18_A	0.693	0.98
81_N	99_I	0.689	0.98
69_Y	141_F	0.688	0.98
120_I	125_G	0.688	0.98
137_G	207_A	0.683	0.97
20_I	24_I	0.682	0.97
148_F	218_T	0.678	0.97
48_I	87_H	0.678	0.97
11_E	15_L	0.677	0.97
131_L	188_I	0.675	0.97
29_D	60_K	0.670	0.97
103_Q	115_V	0.664	0.97
36_T	80_Y	0.663	0.97
32_L	63_T	0.661	0.97
206_D	209_Q	0.660	0.97
236_D	239_A	0.657	0.97
65_N	101_I	0.655	0.97
112_A	181_I	0.654	0.97
72_L	82_H	0.642	0.96
13_C	46_Q	0.638	0.96
133_I	207_A	0.634	0.96
104_G	112_A	0.629	0.96
38_S	83_F	0.627	0.96
17_A	21_K	0.624	0.96
212_A	233_V	0.620	0.96
35_A	44_Y	0.618	0.95
211_M	226_Q	0.614	0.95
38_S	41_V	0.613	0.95
197_L	233_V	0.612	0.95
102_P	116_Y	0.610	0.95
34_L	84_M	0.607	0.95
17_A	46_Q	0.606	0.95
141_F	180_A	0.606	0.95
129_Q	188_I	0.605	0.95
63_T	84_M	0.604	0.95
74_P	105_D	0.603	0.95
38_S	135_A	0.602	0.95
15_L	234_I	0.599	0.95
208_I	212_A	0.597	0.94
27_K	60_K	0.597	0.94
117_E	162_I	0.597	0.94
69_Y	143_E	0.597	0.94
15_L	19_I	0.596	0.94
96_P	99_I	0.596	0.94
21_K	47_L	0.594	0.94
157_L	165_N	0.594	0.94
145_G	218_T	0.593	0.94
108_Q	179_L	0.591	0.94
65_N	81_N	0.591	0.94
120_I	124_G	0.590	0.94
163_Q	173_P	0.589	0.94
72_L	79_S	0.584	0.94
182_S	186_K	0.584	0.94
21_K	55_E	0.577	0.93
78_Q	175_L	0.577	0.93
195_I	225_L	0.576	0.93
72_L	76_H	0.576	0.93
196_V	234_I	0.576	0.93
140_G	182_S	0.575	0.93
64_F	126_I	0.573	0.93
143_E	180_A	0.572	0.93
21_K	54_G	0.569	0.93
185_I	221_P	0.564	0.93
54_G	58_F	0.563	0.93
12_L	42_G	0.562	0.93
173_P	177_P	0.561	0.92
238_K	241_Q	0.560	0.92
185_I	225_L	0.560	0.92
132_G	204_K	0.559	0.92
47_L	58_F	0.556	0.92
187_T	190_E	0.555	0.92
66_L	140_G	0.555	0.92
22_E	26_A	0.552	0.92
214_G	217_T	0.552	0.92
94_M	97_D	0.551	0.92
217_T	223_S	0.549	0.92
162_I	165_N	0.548	0.92
224_I	227_K	0.546	0.91
72_L	75_S	0.545	0.91
24_I	32_L	0.544	0.91
207_A	211_M	0.544	0.91
79_S	104_G	0.542	0.91
84_M	99_I	0.540	0.91
19_I	232_T	0.539	0.91
44_Y	130_I	0.539	0.91
3_I	212_A	0.537	0.91
64_F	120_I	0.530	0.90
70_A	104_G	0.530	0.90
101_I	105_D	0.526	0.90
80_Y	141_F	0.526	0.90
116_Y	120_I	0.526	0.90
108_Q	114_K	0.525	0.90
64_F	116_Y	0.525	0.90
88_L	92_I	0.525	0.90
146_S	219_D	0.524	0.90
80_Y	143_E	0.521	0.89
20_I	47_L	0.520	0.89
13_C	17_A	0.520	0.89
94_M	99_I	0.520	0.89
162_I	178_R	0.517	0.89
129_Q	140_G	0.517	0.89
22_E	25_Q	0.517	0.89
21_K	25_Q	0.516	0.89
19_I	22_E	0.516	0.89
31_V	123_A	0.515	0.89
67_D	204_K	0.514	0.89
67_D	132_G	0.511	0.89
162_I	169_F	0.509	0.88
85_H	89_F	0.508	0.88
63_T	94_M	0.506	0.88
214_G	226_Q	0.505	0.88
106_N	111_A	0.505	0.88
36_T	143_E	0.503	0.88
36_T	69_Y	0.500	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3icoA	1	0.9237	100	0.086	Contact Map
3tx2A	1	0.9197	100	0.091	Contact Map
4tm7A	1	0.9157	100	0.095	Contact Map
3eb9A	1	0.9157	100	0.116	Contact Map
3e15A	2	0.9719	100	0.147	Contact Map
3cssA	1	0.9197	100	0.162	Contact Map
3lwdA	2	0.8755	100	0.174	Contact Map
1ne7A	4	0.996	100	0.176	Contact Map
1vl1A	1	0.8514	100	0.177	Contact Map
1fs5A	4	0.996	100	0.186	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.