SKFG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SKFG - Uncharacterized protein SkfG

UniProt:	O31429	Sequences: MNSNGDKLSLSVQNLANTNEITIVQAIGELKKSGKDAIPVLVEALKEEGSLCNIAAAVLGEFGEDASEAAEELSCLLKSHAEDTRMAAAISLMRIGKPSLPFVIKIAQESEGQSCFWASWCIAWIDPSCIEPKMYKCLKYEHEHPSGIVAPFAAEEALGKLIAFQLKDKED	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (143)
Sequences:	13036 (10336)
Seq/√Len:	864.4

BACSU - SKFG YPGR
HALSA - Q9HQX3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
85_R	109_E	2.745	1.00
47_E	51_L	2.641	1.00
103_V	121_C	2.506	1.00
109_E	114_S	2.484	1.00
17_N	22_T	2.202	1.00
150_A	153_A	2.164	1.00
102_F	105_K	2.100	1.00
73_L	91_S	2.065	1.00
79_S	84_T	2.057	1.00
53_N	57_A	1.929	1.00
144_H	149_V	1.903	1.00
25_Q	28_G	1.889	1.00
14_N	22_T	1.869	1.00
106_I	118_A	1.843	1.00
76_L	88_A	1.819	1.00
54_I	57_A	1.779	1.00
28_G	54_I	1.692	1.00
40_V	44_A	1.635	1.00
23_I	47_E	1.635	1.00
40_V	43_E	1.633	1.00
57_A	61_E	1.629	1.00
14_N	29_E	1.626	1.00
149_V	153_A	1.583	1.00
25_Q	29_E	1.581	1.00
72_E	75_C	1.546	1.00
71_E	75_C	1.538	1.00
24_V	28_G	1.533	1.00
137_C	142_H	1.505	1.00
23_I	27_I	1.496	1.00
21_I	24_V	1.485	1.00
128_S	131_E	1.474	1.00
135_Y	139_K	1.453	1.00
43_E	46_K	1.403	1.00
61_E	64_E	1.397	1.00
144_H	150_A	1.374	1.00
86_M	117_W	1.369	1.00
90_I	94_R	1.366	1.00
86_M	90_I	1.350	1.00
17_N	26_A	1.320	1.00
101_P	105_K	1.315	1.00
14_N	17_N	1.301	1.00
14_N	26_A	1.294	1.00
112_G	116_F	1.294	1.00
146_S	150_A	1.285	1.00
108_Q	140_Y	1.283	1.00
139_K	142_H	1.276	1.00
68_E	71_E	1.260	1.00
76_L	79_S	1.246	1.00
90_I	93_M	1.231	1.00
83_D	86_M	1.208	1.00
93_M	96_G	1.199	1.00
42_V	46_K	1.199	1.00
123_A	126_D	1.193	1.00
56_A	60_G	1.182	1.00
90_I	117_W	1.181	1.00
52_C	55_A	1.178	1.00
41_L	58_V	1.177	1.00
16_A	43_E	1.165	1.00
21_I	25_Q	1.154	1.00
117_W	120_W	1.154	1.00
136_K	140_Y	1.153	1.00
115_C	144_H	1.149	1.00
19_N	22_T	1.140	1.00
93_M	120_W	1.140	1.00
115_C	118_A	1.135	1.00
75_C	78_K	1.132	1.00
148_I	151_P	1.128	1.00
102_F	106_I	1.119	1.00
22_T	25_Q	1.106	1.00
105_K	108_Q	1.096	1.00
89_A	93_M	1.093	1.00
20_E	24_V	1.089	1.00
145_P	150_A	1.080	1.00
82_E	86_M	1.071	1.00
147_G	150_A	1.063	1.00
129_C	132_P	1.056	1.00
145_P	148_I	1.055	1.00
139_K	143_E	1.054	1.00
135_Y	141_E	1.050	1.00
121_C	125_I	1.046	1.00
87_A	90_I	1.037	1.00
54_I	58_V	1.034	1.00
135_Y	140_Y	1.015	1.00
106_I	109_E	1.014	1.00
74_S	78_K	1.013	1.00
120_W	124_W	1.010	1.00
36_D	39_P	1.003	1.00
147_G	151_P	0.999	1.00
16_A	40_V	0.996	1.00
33_S	36_D	0.996	1.00
45_L	59_L	0.993	1.00
24_V	27_I	0.990	1.00
100_L	103_V	0.980	1.00
84_T	87_A	0.973	1.00
28_G	31_K	0.967	1.00
11_S	29_E	0.964	1.00
28_G	32_K	0.958	1.00
134_M	141_E	0.956	1.00
106_I	114_S	0.955	1.00
116_F	119_S	0.943	1.00
31_K	58_V	0.940	1.00
107_A	118_A	0.936	1.00
113_Q	116_F	0.935	1.00
78_K	105_K	0.932	1.00
27_I	31_K	0.927	1.00
20_E	49_G	0.923	1.00
58_V	61_E	0.902	1.00
79_S	88_A	0.893	1.00
13_Q	16_A	0.886	1.00
55_A	58_V	0.880	1.00
20_E	23_I	0.870	1.00
134_M	142_H	0.867	1.00
52_C	79_S	0.865	1.00
148_I	152_F	0.863	1.00
57_A	87_A	0.853	1.00
82_E	111_E	0.848	1.00
144_H	153_A	0.846	1.00
119_S	123_A	0.836	1.00
12_V	16_A	0.821	1.00
72_E	76_L	0.814	1.00
57_A	60_G	0.813	1.00
85_R	89_A	0.812	1.00
88_A	92_L	0.796	1.00
53_N	87_A	0.794	1.00
79_S	85_R	0.792	1.00
133_K	142_H	0.790	1.00
22_T	29_E	0.783	1.00
33_S	39_P	0.782	1.00
78_K	102_F	0.780	1.00
80_H	84_T	0.779	1.00
60_G	63_G	0.775	1.00
116_F	120_W	0.775	1.00
61_E	65_D	0.765	1.00
117_W	121_C	0.763	1.00
16_A	19_N	0.762	1.00
148_I	153_A	0.754	1.00
81_A	84_T	0.745	1.00
24_V	54_I	0.743	1.00
20_E	25_Q	0.742	1.00
25_Q	32_K	0.737	1.00
111_E	114_S	0.736	1.00
46_K	72_E	0.727	1.00
133_K	136_K	0.725	1.00
146_S	149_V	0.718	1.00
89_A	106_I	0.716	1.00
29_E	32_K	0.716	1.00
51_L	54_I	0.708	1.00
110_S	114_S	0.694	1.00
115_C	119_S	0.693	1.00
136_K	142_H	0.691	1.00
98_P	102_F	0.684	1.00
100_L	106_I	0.682	1.00
141_E	144_H	0.681	1.00
17_N	21_I	0.675	1.00
36_D	48_E	0.673	1.00
26_A	29_E	0.665	1.00
104_I	108_Q	0.665	1.00
60_G	94_R	0.664	1.00
93_M	124_W	0.662	1.00
70_A	74_S	0.661	1.00
24_V	32_K	0.661	1.00
68_E	72_E	0.660	1.00
126_D	129_C	0.659	1.00
14_N	27_I	0.659	1.00
60_G	65_D	0.658	1.00
103_V	118_A	0.655	1.00
137_C	140_Y	0.654	1.00
89_A	103_V	0.652	1.00
16_A	31_K	0.651	1.00
22_T	27_I	0.649	1.00
15_L	19_N	0.647	1.00
50_S	53_N	0.646	1.00
27_I	30_L	0.643	1.00
87_A	91_S	0.625	1.00
120_W	123_A	0.619	1.00
44_A	51_L	0.613	1.00
60_G	90_I	0.611	1.00
44_A	55_A	0.600	1.00
139_K	145_P	0.600	1.00
20_E	27_I	0.592	1.00
15_L	30_L	0.590	1.00
48_E	52_C	0.576	1.00
136_K	144_H	0.567	1.00
149_V	152_F	0.563	1.00
48_E	51_L	0.562	1.00
114_S	117_W	0.560	1.00
134_M	139_K	0.555	1.00
117_W	126_D	0.552	1.00
109_E	115_C	0.548	1.00
56_A	88_A	0.548	1.00
141_E	150_A	0.547	1.00
140_Y	144_H	0.541	1.00
89_A	118_A	0.539	1.00
126_D	130_I	0.539	1.00
18_T	25_Q	0.533	1.00
23_I	26_A	0.530	1.00
96_G	99_S	0.529	1.00
97_K	132_P	0.528	1.00
135_Y	145_P	0.528	1.00
82_E	85_R	0.528	1.00
16_A	20_E	0.526	1.00
25_Q	31_K	0.524	1.00
142_H	145_P	0.523	1.00
20_E	30_L	0.522	1.00
145_P	149_V	0.521	1.00
46_K	75_C	0.516	1.00
14_N	18_T	0.511	1.00
96_G	126_D	0.509	1.00
18_T	21_I	0.507	1.00
37_A	40_V	0.507	1.00
76_L	84_T	0.507	1.00
19_N	25_Q	0.506	1.00
56_A	91_S	0.504	1.00
44_A	58_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lacA	1	0.9825	99.5	0.362	Contact Map
4qmiA	1	0.9942	99.5	0.372	Contact Map
4g3aA	1	0.9942	99.4	0.399	Contact Map
4qmhA	1	0.9942	99.4	0.402	Contact Map
2qk2A	1	0.9942	99.4	0.409	Contact Map
1wa5B	1	0.9649	99.4	0.423	Contact Map
3tpoA	1	0.9942	99.4	0.424	Contact Map
1b3uA	1	0.9942	99.3	0.437	Contact Map
1u6gC	1	0.9532	99.3	0.439	Contact Map
3ltmA	1	0.8889	99.3	0.441	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.