MRNC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MRNC - Mini-ribonuclease 3

UniProt:	O31418	Sequences: MLEFDTIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFTKPNDLHKKSSRIVSAKSQAEILFFLQNQSFFTEEEEAVLKRGRNAKSGTTPKNTDVQTYRYSTAFEALLGYLFLEKKEERLSQLVAEAIQFGTSGRKTNESAT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (122)
Sequences:	1131 (817)
Seq/√Len:	74.0

BACSU - MRNC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_L	79_L	4.053	1.00
59_A	101_Y	3.237	1.00
76_E	80_K	2.999	1.00
34_L	49_S	2.920	1.00
63_F	101_Y	2.572	1.00
94_T	98_T	2.497	1.00
79_L	104_A	2.493	1.00
77_A	80_K	2.174	1.00
17_A	35_L	2.112	1.00
61_I	128_A	2.067	1.00
71_F	108_L	2.019	1.00
66_Q	76_E	2.010	1.00
29_Y	121_L	1.977	1.00
87_S	100_R	1.911	1.00
64_F	131_F	1.893	1.00
109_L	124_L	1.837	1.00
105_F	128_A	1.833	1.00
109_L	125_V	1.829	1.00
70_F	127_E	1.810	1.00
33_H	129_I	1.798	1.00
41_K	44_D	1.778	1.00
48_K	51_R	1.762	1.00
29_Y	125_V	1.736	1.00
90_T	96_V	1.696	1.00
105_F	109_L	1.665	1.00
95_D	98_T	1.618	0.99
24_A	27_E	1.580	0.99
96_V	100_R	1.570	0.99
79_L	108_L	1.556	0.99
20_Y	27_E	1.530	0.99
11_K	74_E	1.524	0.99
43_N	47_K	1.521	0.99
32_H	113_F	1.516	0.99
112_L	117_K	1.498	0.99
79_L	101_Y	1.486	0.99
82_G	85_A	1.448	0.99
71_F	79_L	1.439	0.99
10_S	115_E	1.432	0.99
15_G	78_V	1.409	0.99
26_F	111_Y	1.400	0.99
127_E	130_Q	1.359	0.98
15_G	38_G	1.313	0.98
54_S	94_T	1.288	0.97
30_V	129_I	1.230	0.97
56_K	98_T	1.227	0.97
70_F	124_L	1.208	0.96
25_I	109_L	1.203	0.96
39_F	46_H	1.198	0.96
91_P	94_T	1.181	0.96
93_N	98_T	1.174	0.96
26_F	52_I	1.169	0.95
32_H	36_K	1.168	0.95
82_G	107_A	1.112	0.94
66_Q	69_S	1.106	0.94
97_Q	101_Y	1.105	0.94
62_L	104_A	1.053	0.92
21_I	113_F	1.050	0.92
62_L	105_F	1.044	0.92
17_A	45_L	1.043	0.92
25_I	28_V	1.018	0.91
54_S	98_T	1.009	0.90
91_P	95_D	0.997	0.90
109_L	121_L	0.985	0.89
121_L	125_V	0.983	0.89
65_L	124_L	0.982	0.89
27_E	50_S	0.981	0.89
29_Y	122_S	0.958	0.88
55_A	94_T	0.944	0.87
65_L	71_F	0.921	0.86
27_E	31_R	0.907	0.85
103_T	108_L	0.874	0.83
70_F	123_Q	0.870	0.83
78_V	107_A	0.870	0.83
74_E	117_K	0.868	0.82
75_E	120_R	0.861	0.82
34_L	45_L	0.854	0.81
126_A	130_Q	0.852	0.81
62_L	101_Y	0.840	0.80
50_S	91_P	0.838	0.80
42_P	103_T	0.838	0.80
21_I	28_V	0.837	0.80
16_L	87_S	0.831	0.80
127_E	131_F	0.829	0.79
73_E	76_E	0.818	0.79
94_T	102_S	0.807	0.78
125_V	128_A	0.804	0.77
44_D	47_K	0.790	0.76
12_Q	78_V	0.776	0.75
16_L	42_P	0.765	0.74
20_Y	49_S	0.762	0.73
40_T	44_D	0.760	0.73
61_I	131_F	0.752	0.72
80_K	131_F	0.742	0.71
65_L	127_E	0.730	0.70
38_G	107_A	0.724	0.70
13_L	33_H	0.724	0.70
72_T	120_R	0.721	0.69
59_A	98_T	0.719	0.69
29_Y	60_E	0.718	0.69
29_Y	109_L	0.717	0.69
56_K	93_N	0.716	0.69
26_F	71_F	0.715	0.69
17_A	41_K	0.703	0.67
119_E	123_Q	0.703	0.67
14_N	82_G	0.696	0.67
60_E	64_F	0.696	0.67
11_K	115_E	0.693	0.66
16_L	85_A	0.689	0.66
69_S	76_E	0.686	0.65
51_R	57_S	0.680	0.65
96_V	104_A	0.674	0.64
102_S	105_F	0.673	0.64
46_H	49_S	0.672	0.64
21_I	114_L	0.668	0.63
81_R	114_L	0.667	0.63
15_G	40_T	0.667	0.63
80_K	83_R	0.658	0.62
18_L	104_A	0.658	0.62
72_T	117_K	0.654	0.62
65_L	128_A	0.650	0.61
25_I	77_A	0.648	0.61
26_F	50_S	0.643	0.60
46_H	58_Q	0.634	0.59
46_H	50_S	0.631	0.59
69_S	122_S	0.628	0.59
53_V	86_K	0.620	0.58
125_V	129_I	0.619	0.58
55_A	83_R	0.613	0.57
64_F	127_E	0.612	0.57
14_N	39_F	0.612	0.57
102_S	121_L	0.610	0.56
64_F	69_S	0.609	0.56
25_I	125_V	0.608	0.56
58_Q	102_S	0.600	0.55
63_F	69_S	0.597	0.55
100_R	103_T	0.596	0.55
75_E	110_G	0.596	0.55
39_F	102_S	0.596	0.55
122_S	125_V	0.591	0.54
14_N	52_I	0.591	0.54
34_L	91_P	0.585	0.53
21_I	35_L	0.584	0.53
90_T	104_A	0.582	0.53
17_A	20_Y	0.566	0.51
31_R	59_A	0.565	0.51
101_Y	104_A	0.565	0.51
121_L	126_A	0.564	0.51
97_Q	130_Q	0.563	0.51
17_A	42_P	0.563	0.51
78_V	108_L	0.563	0.51
119_E	131_F	0.558	0.50
30_V	125_V	0.556	0.50
46_H	90_T	0.554	0.49
51_R	118_E	0.551	0.49
13_L	41_K	0.548	0.49
8_K	119_E	0.547	0.49
10_S	14_N	0.546	0.49
28_V	49_S	0.545	0.48
21_I	32_H	0.544	0.48
8_K	12_Q	0.542	0.48
123_Q	126_A	0.541	0.48
33_H	37_Q	0.540	0.48
18_L	85_A	0.530	0.47
61_I	91_P	0.529	0.46
20_Y	30_V	0.529	0.46
36_K	64_F	0.529	0.46
57_S	92_K	0.525	0.46
108_L	112_L	0.523	0.46
16_L	96_V	0.522	0.46
74_E	126_A	0.519	0.45
73_E	119_E	0.518	0.45
20_Y	50_S	0.518	0.45
57_S	71_F	0.517	0.45
65_L	123_Q	0.517	0.45
89_T	100_R	0.515	0.45
123_Q	127_E	0.511	0.44
46_H	95_D	0.511	0.44
44_D	119_E	0.509	0.44
15_G	103_T	0.508	0.44
32_H	122_S	0.507	0.44
65_L	70_F	0.505	0.43
83_R	93_N	0.502	0.43
85_A	100_R	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ounA	2	0.8741	100	0.455	Contact Map
2gslA	2	0.9161	100	0.473	Contact Map
1u61A	1	0.8881	100	0.484	Contact Map
3o2rA	2	0.8671	99.6	0.698	Contact Map
2a11A	2	0.9021	99.5	0.716	Contact Map
3n3wA	2	0.8741	99.4	0.728	Contact Map
1vw49	1	0.8462	99.3	0.735	Contact Map
2nugA	2	0.8741	99.3	0.735	Contact Map
1o0wA	2	0.9161	99.3	0.739	Contact Map
3rv1A	2	0.8601	99.3	0.745	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.