AZLD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AZLD - Branched-chain amino acid transport protein AzlD

UniProt:	O07923	Sequences: MTMTMTQQMITIAMVVLGTMLTRFLPFMIFPSGKPTPKYVQYLGKVLPSAVIGLLVIYCLKDVSLLSGSHGIPELVGAAAVVLLHLWKKNMLLSIAGGTVVYMVLVQLVF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	110 (103)
Sequences:	575 (463)
Seq/√Len:	45.6

BACSU - AZLD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_M	24_F	4.305	1.00
80_A	101_V	3.937	1.00
60_L	78_A	3.348	1.00
86_L	89_K	3.169	1.00
81_V	98_G	3.036	1.00
85_H	94_S	2.929	1.00
84_L	97_G	2.759	1.00
104_V	108_L	2.631	1.00
83_L	87_W	2.236	1.00
88_K	93_L	2.110	1.00
7_Q	11_T	2.039	0.99
76_V	101_V	1.844	0.99
6_T	9_M	1.822	0.99
42_Y	46_V	1.717	0.98
8_Q	11_T	1.714	0.98
77_G	81_V	1.710	0.98
103_M	107_Q	1.674	0.98
77_G	101_V	1.570	0.97
47_L	50_A	1.510	0.96
18_G	22_T	1.473	0.95
27_F	85_H	1.469	0.95
63_V	71_G	1.465	0.95
22_T	95_I	1.315	0.91
43_L	46_V	1.295	0.90
7_Q	25_L	1.287	0.90
11_T	15_V	1.282	0.90
70_H	74_E	1.256	0.89
14_M	18_G	1.249	0.89
8_Q	91_M	1.244	0.89
48_P	98_G	1.221	0.88
14_M	17_L	1.218	0.88
15_V	52_I	1.213	0.87
36_T	54_L	1.200	0.87
32_S	36_T	1.198	0.87
52_I	91_M	1.189	0.86
10_I	76_V	1.180	0.86
38_K	56_V	1.174	0.86
80_A	83_L	1.173	0.85
71_G	74_E	1.158	0.85
80_A	105_L	1.152	0.84
13_A	48_P	1.150	0.84
12_I	16_V	1.147	0.84
92_L	107_Q	1.140	0.84
13_A	80_A	1.127	0.83
15_V	51_V	1.103	0.82
91_M	95_I	1.085	0.81
15_V	18_G	1.071	0.80
51_V	54_L	1.056	0.79
29_I	58_Y	1.048	0.78
43_L	50_A	1.021	0.76
85_H	99_T	1.015	0.76
30_F	61_K	1.008	0.76
10_I	14_M	0.997	0.75
15_V	46_V	0.985	0.74
75_L	97_G	0.962	0.72
102_Y	106_V	0.954	0.71
38_K	89_K	0.941	0.70
92_L	96_A	0.941	0.70
44_G	50_A	0.932	0.70
22_T	25_L	0.931	0.70
8_Q	52_I	0.917	0.68
41_Q	45_K	0.910	0.68
56_V	61_K	0.909	0.68
17_L	21_L	0.899	0.67
8_Q	49_S	0.888	0.66
44_G	57_I	0.873	0.65
11_T	18_G	0.862	0.64
99_T	103_M	0.851	0.63
24_F	28_M	0.848	0.62
32_S	51_V	0.845	0.62
53_G	57_I	0.840	0.61
46_V	91_M	0.827	0.60
74_E	102_Y	0.827	0.60
31_P	53_G	0.826	0.60
21_L	25_L	0.825	0.60
18_G	24_F	0.821	0.60
69_S	74_E	0.819	0.60
38_K	41_Q	0.817	0.59
79_A	97_G	0.813	0.59
29_I	62_D	0.792	0.57
43_L	102_Y	0.790	0.57
56_V	85_H	0.773	0.55
33_G	50_A	0.750	0.53
34_K	87_W	0.739	0.52
9_M	13_A	0.736	0.52
101_V	104_V	0.731	0.51
49_S	59_C	0.716	0.50
77_G	80_A	0.712	0.49
40_V	76_V	0.704	0.48
36_T	96_A	0.689	0.47
36_T	47_L	0.681	0.46
94_S	99_T	0.673	0.45
24_F	29_I	0.664	0.44
72_I	79_A	0.661	0.44
13_A	93_L	0.656	0.44
75_L	108_L	0.655	0.44
24_F	53_G	0.653	0.43
54_L	66_L	0.649	0.43
36_T	50_A	0.642	0.42
70_H	73_P	0.641	0.42
66_L	70_H	0.630	0.41
76_V	99_T	0.630	0.41
75_L	79_A	0.623	0.41
85_H	107_Q	0.622	0.40
32_S	35_P	0.621	0.40
83_L	97_G	0.615	0.40
7_Q	19_T	0.615	0.40
84_L	87_W	0.613	0.40
10_I	67_S	0.602	0.39
33_G	51_V	0.600	0.38
35_P	41_Q	0.595	0.38
31_P	34_K	0.593	0.38
20_M	81_V	0.592	0.38
30_F	47_L	0.589	0.37
46_V	103_M	0.586	0.37
28_M	108_L	0.583	0.37
42_Y	92_L	0.573	0.36
73_P	105_L	0.569	0.36
88_K	94_S	0.565	0.35
90_N	101_V	0.565	0.35
49_S	96_A	0.565	0.35
36_T	39_Y	0.561	0.35
15_V	49_S	0.560	0.35
53_G	108_L	0.558	0.35
78_A	96_A	0.556	0.34
52_I	96_A	0.553	0.34
54_L	106_V	0.548	0.34
7_Q	10_I	0.547	0.34
36_T	91_M	0.543	0.33
14_M	65_L	0.543	0.33
93_L	97_G	0.541	0.33
64_S	67_S	0.540	0.33
37_P	98_G	0.540	0.33
41_Q	56_V	0.540	0.33
75_L	78_A	0.539	0.33
37_P	106_V	0.536	0.33
19_T	24_F	0.534	0.32
47_L	53_G	0.532	0.32
16_V	20_M	0.530	0.32
55_L	93_L	0.520	0.31
49_S	89_K	0.520	0.31
100_V	108_L	0.520	0.31
82_V	86_L	0.518	0.31
81_V	87_W	0.513	0.31
40_V	44_G	0.512	0.31
99_T	105_L	0.510	0.30
22_T	36_T	0.509	0.30
14_M	21_L	0.507	0.30
15_V	22_T	0.507	0.30
14_M	29_I	0.504	0.30
10_I	75_L	0.503	0.30
28_M	79_A	0.501	0.30
47_L	57_I	0.500	0.30
38_K	57_I	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xp4A	1	0.9364	6.8	0.939	Contact Map
3qe7A	2	0.9182	6.6	0.94	Contact Map
3p5nA	2	0.9545	4.3	0.945	Contact Map
4hfiA	3	0.5727	2.8	0.95	Contact Map
3rqwA	4	0.5364	2.7	0.95	Contact Map
4wfeA	2	0.2091	2.4	0.951	Contact Map
4xk8I	1	0.2636	2.3	0.952	Contact Map
3wu2X	1	0.2545	1.8	0.954	Contact Map
2m59A	2	0.3364	1.5	0.957	Contact Map
2wscI	1	0.2727	1.5	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.