AZLB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AZLB - Transcriptional regulator AzlB

UniProt:	O07920	Sequences: MGIMLDETDKAILRDLQEDASISNLNLSKKIGLSPSACLARTKNLVEAGIIKKFTTIVDEKKLGIEVTALALINLSPLNRETIHSFLEDINKFPQVQECYTLTGSHDYMLKIVAKDMESYRNFIIDSLMQNPAISGVDTSIVMSTEKRTVSVPIDEM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (140)
Sequences:	13604 (8854)
Seq/√Len:	748.3

ECOLI - YBAO LRP ASNC
BACSU - AZLB YWRC LRPB YUGG LRPC YEZC LRPA
HALSA - Q9HQ13 Q9HNI1 Q9HQ33 Q9HQB6 Q9HP41 Q9HQG1 Q9HNW8 Q9HP70
SULSO - Q97W90 Q7LXS6 Q7LX67 Q97XP7 LYSM Q97X78 Q980P3 Q97VN7 Q97VH3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_D	30_K	2.907	1.00
46_V	54_F	2.907	1.00
98_E	111_K	2.516	1.00
105_S	138_D	2.503	1.00
74_N	136_G	2.492	1.00
24_N	42_T	2.298	1.00
115_K	119_S	2.286	1.00
61_K	118_E	2.135	1.00
52_K	59_D	2.043	1.00
15_D	22_I	2.024	1.00
9_D	41_R	2.022	1.00
44_N	48_A	1.998	1.00
76_S	135_S	1.874	1.00
70_L	100_Y	1.857	1.00
82_T	85_S	1.824	1.00
93_F	127_S	1.811	1.00
68_T	111_K	1.791	1.00
52_K	57_I	1.788	1.00
8_T	33_L	1.732	1.00
97_Q	113_V	1.723	1.00
43_K	47_E	1.694	1.00
93_F	123_F	1.673	1.00
15_D	18_E	1.668	1.00
33_L	37_A	1.657	1.00
72_L	140_S	1.620	1.00
25_L	29_K	1.573	1.00
116_D	119_S	1.556	1.00
22_I	30_K	1.537	1.00
119_S	122_N	1.497	1.00
26_N	29_K	1.492	1.00
89_D	92_K	1.486	1.00
25_L	35_P	1.467	1.00
33_L	38_C	1.463	1.00
95_Q	119_S	1.460	1.00
145_T	148_R	1.438	1.00
89_D	131_N	1.423	1.00
86_F	90_I	1.422	1.00
34_S	37_A	1.406	1.00
12_I	27_L	1.401	1.00
24_N	39_L	1.394	1.00
87_L	91_N	1.370	1.00
31_I	38_C	1.366	1.00
73_I	110_L	1.359	1.00
21_S	54_F	1.338	1.00
71_A	112_I	1.332	1.00
122_N	126_D	1.324	1.00
84_H	88_E	1.316	1.00
7_E	11_A	1.286	1.00
74_N	105_S	1.277	1.00
22_I	27_L	1.276	1.00
72_L	106_H	1.275	1.00
16_L	42_T	1.266	1.00
67_V	117_M	1.239	1.00
65_I	115_K	1.239	1.00
121_R	144_S	1.232	1.00
75_L	86_F	1.231	1.00
26_N	30_K	1.229	1.00
8_T	11_A	1.198	1.00
18_E	30_K	1.194	1.00
43_K	46_V	1.189	1.00
74_N	135_S	1.179	1.00
87_L	144_S	1.169	1.00
95_Q	127_S	1.164	1.00
23_S	26_N	1.157	1.00
19_D	30_K	1.154	1.00
6_D	41_R	1.129	1.00
15_D	27_L	1.121	1.00
8_T	31_I	1.075	1.00
53_K	57_I	1.065	1.00
72_L	138_D	1.056	1.00
24_N	28_S	1.049	1.00
11_A	14_R	1.029	1.00
11_A	15_D	1.024	1.00
68_T	113_V	1.014	1.00
96_V	112_I	1.013	1.00
14_R	18_E	1.004	1.00
87_L	108_Y	1.000	1.00
99_C	110_L	0.989	1.00
114_A	120_Y	0.987	1.00
22_I	26_N	0.983	1.00
28_S	38_C	0.975	1.00
85_S	89_D	0.972	1.00
88_E	91_N	0.958	1.00
70_L	109_M	0.957	1.00
114_A	119_S	0.953	1.00
112_I	123_F	0.953	1.00
39_L	43_K	0.939	1.00
20_A	54_F	0.925	1.00
70_L	111_K	0.923	1.00
59_D	62_K	0.922	1.00
102_L	109_M	0.918	1.00
35_P	39_L	0.915	1.00
66_E	116_D	0.915	1.00
114_A	123_F	0.909	1.00
24_N	35_P	0.906	1.00
21_S	46_V	0.899	1.00
11_A	31_I	0.898	1.00
100_Y	111_K	0.897	1.00
5_L	10_K	0.893	1.00
88_E	92_K	0.890	1.00
28_S	33_L	0.886	1.00
45_L	50_I	0.847	1.00
105_S	136_G	0.842	1.00
60_E	113_V	0.836	1.00
70_L	142_V	0.833	1.00
96_V	99_C	0.809	1.00
96_V	110_L	0.809	1.00
25_L	39_L	0.807	1.00
9_D	44_N	0.802	1.00
20_A	26_N	0.799	1.00
100_Y	145_T	0.798	1.00
76_S	82_T	0.798	1.00
10_K	14_R	0.797	1.00
100_Y	142_V	0.796	1.00
90_I	99_C	0.792	1.00
124_I	139_T	0.785	1.00
6_D	9_D	0.775	1.00
89_D	93_F	0.772	1.00
78_L	82_T	0.770	1.00
85_S	88_E	0.768	1.00
73_I	86_F	0.764	1.00
122_N	127_S	0.760	1.00
20_A	56_T	0.757	1.00
27_L	38_C	0.749	1.00
72_L	109_M	0.748	1.00
83_I	108_Y	0.742	1.00
103_T	141_I	0.739	1.00
36_S	40_A	0.734	1.00
84_H	87_L	0.734	1.00
106_H	138_D	0.729	1.00
12_I	38_C	0.724	1.00
27_L	42_T	0.719	1.00
5_L	50_I	0.716	1.00
12_I	41_R	0.708	1.00
69_A	120_Y	0.707	1.00
19_D	22_I	0.702	1.00
85_S	133_A	0.690	1.00
12_I	22_I	0.686	1.00
129_M	137_V	0.685	1.00
15_D	19_D	0.683	1.00
65_I	113_V	0.682	1.00
71_A	137_V	0.674	1.00
86_F	108_Y	0.674	1.00
74_N	106_H	0.670	1.00
13_L	45_L	0.664	1.00
40_A	44_N	0.663	1.00
7_E	10_K	0.663	1.00
95_Q	123_F	0.662	1.00
118_E	121_R	0.661	1.00
65_I	95_Q	0.658	1.00
50_I	62_K	0.657	1.00
72_L	105_S	0.654	1.00
118_E	122_N	0.653	1.00
117_M	141_I	0.652	1.00
87_L	146_E	0.646	1.00
101_T	108_Y	0.644	1.00
71_A	110_L	0.640	1.00
28_S	35_P	0.638	1.00
90_I	110_L	0.637	1.00
40_A	43_K	0.629	1.00
76_S	133_A	0.628	1.00
20_A	53_K	0.622	1.00
68_T	142_V	0.621	1.00
12_I	15_D	0.620	1.00
69_A	141_I	0.617	1.00
77_P	82_T	0.617	1.00
73_I	134_I	0.616	1.00
49_G	52_K	0.608	1.00
95_Q	115_K	0.605	1.00
68_T	145_T	0.604	1.00
93_F	131_N	0.603	1.00
102_L	106_H	0.602	1.00
58_V	63_L	0.600	1.00
9_D	45_L	0.599	1.00
124_I	137_V	0.595	1.00
36_S	39_L	0.595	1.00
69_A	139_T	0.594	1.00
12_I	42_T	0.590	1.00
41_R	45_L	0.589	1.00
24_N	38_C	0.587	1.00
59_D	63_L	0.587	1.00
68_T	100_Y	0.570	1.00
51_I	54_F	0.567	1.00
119_S	123_F	0.566	1.00
12_I	45_L	0.554	1.00
73_I	137_V	0.550	1.00
84_H	130_Q	0.547	1.00
8_T	37_A	0.544	1.00
127_S	131_N	0.543	1.00
117_M	143_M	0.537	1.00
123_F	127_S	0.533	1.00
98_E	148_R	0.533	1.00
93_F	96_V	0.529	1.00
44_N	47_E	0.528	1.00
19_D	26_N	0.526	1.00
123_F	128_L	0.521	1.00
14_R	17_Q	0.520	1.00
89_D	133_A	0.518	1.00
101_T	121_R	0.518	1.00
25_L	28_S	0.518	1.00
102_L	142_V	0.518	1.00
75_L	107_D	0.515	1.00
85_S	132_P	0.515	1.00
82_T	133_A	0.512	1.00
69_A	114_A	0.511	1.00
105_S	140_S	0.511	1.00
17_Q	55_T	0.507	1.00
72_L	102_L	0.506	1.00
75_L	83_I	0.503	1.00
120_Y	141_I	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ch7A	1	0.8662	100	0.169	Contact Map
2e1cA	1	0.9363	100	0.181	Contact Map
4un1B	1	0.9554	100	0.187	Contact Map
2p5vA	5	0.9936	100	0.189	Contact Map
4un1A	1	0.9045	100	0.189	Contact Map
4pcqA	2	0.9618	100	0.213	Contact Map
3i4pA	5	0.9682	100	0.217	Contact Map
2cyyA	2	0.9618	100	0.235	Contact Map
2pn6A	5	0.9363	100	0.242	Contact Map
2cg4A	6	0.949	100	0.244	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.