YRAL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YRAL - Uncharacterized protein YraL

UniProt:	O07917	Sequences: MAYVKATAILPEKLISEIQKYVQGKTIYIPKPESSHQKWGACSGTRKLIDDRNASIKKAFKNGKTIHQLSDEYHLSIETIKKIVYSK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	87 (85)
Sequences:	421 (340)
Seq/√Len:	36.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_A	72_E	4.856	1.00
17_E	20_K	3.803	1.00
55_S	59_A	3.153	1.00
10_L	27_I	2.737	1.00
23_Q	31_K	2.668	1.00
56_I	80_I	2.211	0.99
14_L	17_E	2.117	0.99
78_E	81_K	1.886	0.98
38_K	41_A	1.833	0.97
44_G	81_K	1.805	0.97
15_I	18_I	1.734	0.96
22_V	25_K	1.640	0.95
57_K	79_T	1.608	0.94
10_L	15_I	1.562	0.93
46_R	76_S	1.509	0.92
4_V	9_I	1.482	0.92
2_A	78_E	1.475	0.91
37_Q	42_C	1.465	0.91
27_I	37_Q	1.425	0.90
2_A	81_K	1.417	0.90
32_P	35_S	1.408	0.89
82_K	85_Y	1.345	0.87
14_L	82_K	1.341	0.87
79_T	82_K	1.287	0.84
47_K	50_D	1.272	0.84
57_K	60_F	1.270	0.84
68_Q	71_D	1.215	0.81
7_T	76_S	1.197	0.80
26_T	43_S	1.195	0.80
45_T	49_I	1.174	0.78
48_L	74_H	1.168	0.78
67_H	77_I	1.121	0.75
23_Q	32_P	1.114	0.75
57_K	85_Y	1.108	0.74
81_K	85_Y	1.098	0.74
10_L	18_I	1.095	0.73
66_I	77_I	1.087	0.73
23_Q	78_E	1.059	0.71
26_T	78_E	1.042	0.70
71_D	77_I	1.040	0.69
13_K	74_H	1.039	0.69
57_K	61_K	1.016	0.68
58_K	62_N	0.997	0.66
59_A	73_Y	0.987	0.65
45_T	48_L	0.954	0.63
37_Q	41_A	0.950	0.62
76_S	79_T	0.950	0.62
43_S	76_S	0.934	0.61
15_I	26_T	0.920	0.60
4_V	58_K	0.906	0.59
2_A	44_G	0.903	0.58
55_S	69_L	0.901	0.58
22_V	62_N	0.889	0.57
24_G	79_T	0.863	0.55
57_K	82_K	0.863	0.55
35_S	62_N	0.858	0.54
16_S	79_T	0.857	0.54
53_N	82_K	0.849	0.54
12_E	16_S	0.845	0.53
77_I	85_Y	0.836	0.53
31_K	78_E	0.828	0.52
6_A	27_I	0.819	0.51
6_A	26_T	0.819	0.51
23_Q	26_T	0.817	0.51
29_I	82_K	0.807	0.50
47_K	51_D	0.807	0.50
59_A	64_K	0.798	0.49
5_K	35_S	0.790	0.49
5_K	10_L	0.769	0.47
43_S	69_L	0.764	0.46
9_I	27_I	0.764	0.46
8_A	36_H	0.758	0.46
9_I	32_P	0.756	0.46
20_K	61_K	0.754	0.45
54_A	58_K	0.752	0.45
77_I	82_K	0.740	0.44
25_K	46_R	0.738	0.44
64_K	72_E	0.735	0.44
47_K	67_H	0.734	0.44
4_V	25_K	0.731	0.43
14_L	84_V	0.712	0.42
60_F	84_V	0.697	0.40
67_H	70_S	0.688	0.40
69_L	80_I	0.677	0.39
38_K	51_D	0.673	0.38
31_K	57_K	0.661	0.37
6_A	37_Q	0.647	0.36
76_S	85_Y	0.647	0.36
46_R	49_I	0.638	0.36
12_E	50_D	0.626	0.35
65_T	68_Q	0.625	0.35
9_I	48_L	0.615	0.34
33_E	54_A	0.610	0.33
71_D	74_H	0.607	0.33
38_K	47_K	0.604	0.33
20_K	25_K	0.604	0.33
43_S	81_K	0.602	0.33
80_I	84_V	0.602	0.33
2_A	43_S	0.594	0.32
16_S	48_L	0.592	0.32
37_Q	49_I	0.590	0.32
27_I	50_D	0.589	0.32
4_V	14_L	0.588	0.32
8_A	18_I	0.587	0.32
3_Y	9_I	0.579	0.31
78_E	82_K	0.576	0.31
15_I	37_Q	0.574	0.31
33_E	38_K	0.568	0.30
13_K	78_E	0.567	0.30
49_I	74_H	0.564	0.30
6_A	74_H	0.562	0.30
66_I	81_K	0.557	0.29
44_G	66_I	0.551	0.29
35_S	38_K	0.550	0.29
33_E	36_H	0.547	0.29
16_S	65_T	0.547	0.29
2_A	50_D	0.544	0.28
70_S	74_H	0.541	0.28
34_S	42_C	0.540	0.28
12_E	33_E	0.539	0.28
14_L	60_F	0.539	0.28
8_A	68_Q	0.536	0.28
18_I	29_I	0.535	0.28
16_S	32_P	0.532	0.28
45_T	59_A	0.531	0.27
57_K	81_K	0.522	0.27
42_C	67_H	0.511	0.26
13_K	76_S	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rr7A	2	0.7931	99.4	0.601	Contact Map
3korA	2	0.9195	95.9	0.821	Contact Map
2w48A	3	0.4483	91	0.855	Contact Map
1tc3C	1	0.5057	89.6	0.859	Contact Map
1fseA	2	0.5287	88.7	0.862	Contact Map
1jkoC	1	0.5057	88.5	0.862	Contact Map
4wszA	2	0.5057	88	0.863	Contact Map
2jpcA	1	0.4253	88	0.863	Contact Map
4ldzA	2	0.9195	87.7	0.864	Contact Map
1x3uA	1	0.6322	87.7	0.864	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.