YLAH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLAH - Uncharacterized membrane protein YlaH

UniProt:	O07632	Sequences: MNDVSERLSFFAALYQVDRQPAAGMWLLYGTIFVLAVIVFKLGFAKRLPVLKSAVVYVFLALGCTVLTFLGVFLPVAEGLVVAALILIIYKIRLYQSKKGQSAKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	105 (96)
Sequences:	132 (94)
Seq/√Len:	9.5

BACSU - YLAH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_K	98_K	3.558	0.97
49_P	52_K	3.014	0.92
40_F	53_S	2.980	0.92
34_V	38_I	2.635	0.85
50_V	54_A	2.431	0.80
39_V	83_A	2.419	0.80
33_F	61_A	2.386	0.79
41_K	88_I	2.367	0.78
59_F	88_I	1.886	0.60
91_K	94_L	1.859	0.59
46_K	99_K	1.679	0.51
29_Y	61_A	1.654	0.50
94_L	98_K	1.638	0.49
69_F	73_F	1.606	0.48
33_F	37_V	1.593	0.47
37_V	61_A	1.568	0.46
62_L	101_Q	1.530	0.45
59_F	86_I	1.513	0.44
61_A	65_T	1.480	0.42
17_V	25_M	1.441	0.41
88_I	91_K	1.433	0.40
88_I	92_I	1.425	0.40
71_G	77_A	1.407	0.39
39_V	91_K	1.374	0.38
32_I	64_C	1.373	0.38
10_F	31_T	1.365	0.37
59_F	85_L	1.347	0.37
51_L	58_V	1.336	0.36
77_A	99_K	1.314	0.35
41_K	59_F	1.299	0.35
95_Y	98_K	1.293	0.34
24_G	28_L	1.288	0.34
54_A	102_S	1.260	0.33
41_K	97_S	1.258	0.33
60_L	93_R	1.244	0.33
89_I	101_Q	1.244	0.33
32_I	35_L	1.227	0.32
41_K	53_S	1.220	0.32
79_G	88_I	1.210	0.31
29_Y	51_L	1.138	0.28
28_L	71_G	1.087	0.27
36_A	54_A	1.081	0.26
41_K	60_L	1.071	0.26
26_W	83_A	1.063	0.26
83_A	91_K	1.057	0.26
74_L	79_G	1.044	0.25
15_Y	31_T	1.019	0.24
30_G	34_V	1.019	0.24
92_I	98_K	0.961	0.22
55_V	101_Q	0.960	0.22
60_L	79_G	0.948	0.22
17_V	72_V	0.946	0.22
82_V	86_I	0.938	0.22
9_S	52_K	0.934	0.22
14_L	48_L	0.926	0.21
92_I	100_G	0.919	0.21
62_L	71_G	0.917	0.21
11_F	25_M	0.913	0.21
56_V	74_L	0.906	0.21
23_A	27_L	0.901	0.21
11_F	31_T	0.896	0.21
33_F	49_P	0.891	0.20
49_P	61_A	0.879	0.20
8_L	13_A	0.877	0.20
8_L	16_Q	0.877	0.20
12_A	28_L	0.874	0.20
14_L	17_V	0.865	0.20
32_I	70_L	0.862	0.20
31_T	82_V	0.857	0.19
81_V	96_Q	0.849	0.19
11_F	17_V	0.847	0.19
46_K	88_I	0.845	0.19
74_L	78_E	0.842	0.19
55_V	95_Y	0.837	0.19
46_K	55_V	0.831	0.19
91_K	96_Q	0.819	0.18
59_F	79_G	0.804	0.18
16_Q	37_V	0.800	0.18
64_C	74_L	0.799	0.18
32_I	37_V	0.793	0.18
42_L	87_L	0.789	0.18
51_L	61_A	0.786	0.17
46_K	59_F	0.785	0.17
40_F	47_R	0.783	0.17
81_V	102_S	0.774	0.17
67_L	73_F	0.759	0.17
39_V	84_A	0.756	0.17
68_T	71_G	0.752	0.17
30_G	66_V	0.747	0.17
54_A	95_Y	0.744	0.16
34_V	101_Q	0.728	0.16
20_Q	69_F	0.722	0.16
10_F	25_M	0.722	0.16
21_P	72_V	0.722	0.16
24_G	77_A	0.715	0.16
52_K	95_Y	0.707	0.16
15_Y	30_G	0.699	0.15
30_G	40_F	0.690	0.15
29_Y	49_P	0.680	0.15
81_V	85_L	0.679	0.15
41_K	46_K	0.668	0.15
47_R	56_V	0.661	0.14
13_A	16_Q	0.653	0.14
48_L	52_K	0.651	0.14
68_T	78_E	0.648	0.14
7_R	10_F	0.644	0.14
85_L	88_I	0.642	0.14
40_F	85_L	0.640	0.14
46_K	62_L	0.634	0.14
16_Q	30_G	0.626	0.14
16_Q	70_L	0.623	0.14
52_K	61_A	0.616	0.14
55_V	86_I	0.611	0.13
38_I	85_L	0.611	0.13
38_I	58_V	0.608	0.13
10_F	35_L	0.605	0.13
67_L	93_R	0.602	0.13
18_D	24_G	0.601	0.13
36_A	47_R	0.593	0.13
32_I	91_K	0.592	0.13
66_V	77_A	0.591	0.13
25_M	56_V	0.583	0.13
64_C	93_R	0.580	0.13
56_V	59_F	0.569	0.13
38_I	100_G	0.565	0.12
70_L	94_L	0.553	0.12
20_Q	61_A	0.553	0.12
28_L	32_I	0.553	0.12
66_V	73_F	0.551	0.12
8_L	25_M	0.540	0.12
38_I	46_K	0.538	0.12
26_W	31_T	0.531	0.12
36_A	98_K	0.530	0.12
28_L	67_L	0.527	0.12
47_R	70_L	0.522	0.12
25_M	79_G	0.521	0.12
9_S	77_A	0.520	0.12
29_Y	56_V	0.516	0.12
8_L	11_F	0.512	0.11
66_V	82_V	0.512	0.11
25_M	72_V	0.511	0.11
58_V	62_L	0.507	0.11
40_F	56_V	0.504	0.11
95_Y	99_K	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mndA	2	0.8571	38.5	0.921	Contact Map
2xq2A	2	0.6667	26.2	0.928	Contact Map
2bg9C	1	0.8571	17.4	0.934	Contact Map
2k1aA	1	0.3238	15	0.936	Contact Map
2bg9E	1	0.8667	12.6	0.938	Contact Map
3l1lA	2	0.9143	10.1	0.94	Contact Map
4ev6A	3	0.4667	9.6	0.941	Contact Map
4hfiA	3	0.8	9.5	0.941	Contact Map
4cofA	3	0.7619	8.8	0.942	Contact Map
4aq5E	1	0.7333	8.4	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.