BIOY - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BIOY - Probable biotin transporter BioY

UniProt:	O07620	Sequences: MLKLIDMMHIAIFTALMAVLGFMPPLFLSFTPVPITLQTLGVMLAGSILRPKSAFLSQLVFLLLVAFGAPLLPGGRGGFGVFFGPSAGFLIAYPLASWLISLAANRLRKVTVLRLFFTHIVFGIIFIYLLGIPVQAFIMHIDLSQAAFMSLAYVPGDLIKAAVSAFLAIKITQALSLSDTMFTKGG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	186 (170)
Sequences:	2707 (2152)
Seq/√Len:	165.0

BACSU - BIOY BIOYB
HALSA - Q9HMZ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_M	58_Q	4.009	1.00
62_L	90_L	3.154	1.00
65_V	72_L	3.080	1.00
20_L	41_G	2.978	1.00
51_P	105_N	2.881	1.00
50_R	101_S	2.704	1.00
10_I	53_S	2.655	1.00
6_D	53_S	2.456	1.00
136_A	143_L	2.425	1.00
50_R	54_A	2.400	1.00
96_A	127_I	2.250	1.00
55_F	94_P	2.181	1.00
99_L	126_F	2.101	1.00
47_S	168_A	1.972	1.00
145_Q	149_M	1.905	1.00
59_L	94_P	1.897	1.00
18_A	71_L	1.875	1.00
13_F	45_A	1.861	1.00
132_I	150_S	1.828	1.00
64_L	69_A	1.817	1.00
128_Y	157_D	1.790	1.00
87_A	134_V	1.750	1.00
55_F	98_W	1.720	1.00
14_T	60_V	1.707	1.00
148_F	151_L	1.691	1.00
62_L	94_P	1.689	1.00
92_A	130_L	1.652	1.00
28_L	31_T	1.650	1.00
36_T	39_T	1.648	1.00
21_G	61_F	1.611	1.00
38_Q	93_Y	1.607	1.00
142_D	145_Q	1.605	1.00
147_A	151_L	1.605	1.00
95_L	130_L	1.530	1.00
84_G	87_A	1.529	1.00
103_A	119_H	1.527	1.00
154_V	158_L	1.494	1.00
54_A	101_S	1.478	1.00
128_Y	150_S	1.452	1.00
14_T	18_A	1.449	1.00
76_R	81_V	1.448	1.00
14_T	57_S	1.446	1.00
132_I	146_A	1.431	1.00
51_P	98_W	1.389	1.00
47_S	120_I	1.380	1.00
92_A	127_I	1.376	1.00
130_L	133_P	1.363	1.00
65_V	71_L	1.362	1.00
22_F	75_G	1.361	1.00
14_T	64_L	1.359	1.00
17_M	45_A	1.337	1.00
4_L	8_M	1.326	1.00
89_F	135_Q	1.286	1.00
135_Q	139_M	1.284	1.00
100_I	123_G	1.251	1.00
124_I	128_Y	1.247	1.00
56_L	59_L	1.245	1.00
151_L	155_P	1.236	1.00
62_L	82_F	1.225	1.00
111_T	114_R	1.179	1.00
132_I	147_A	1.177	1.00
135_Q	141_I	1.175	1.00
47_S	104_A	1.171	1.00
134_V	138_I	1.170	1.00
158_L	162_A	1.168	1.00
27_F	31_T	1.153	1.00
36_T	93_Y	1.153	1.00
61_F	72_L	1.129	1.00
135_Q	146_A	1.124	1.00
17_M	42_V	1.117	1.00
66_A	79_F	1.116	1.00
141_I	149_M	1.114	1.00
129_L	133_P	1.101	1.00
40_L	163_V	1.100	1.00
40_L	164_S	1.089	1.00
134_V	137_F	1.077	1.00
120_I	161_A	1.067	0.99
152_A	155_P	1.061	0.99
27_F	30_F	1.061	0.99
66_A	77_G	1.058	0.99
46_G	54_A	1.044	0.99
45_A	49_L	1.028	0.99
51_P	101_S	1.026	0.99
58_Q	97_S	1.024	0.99
79_F	83_F	1.021	0.99
49_L	57_S	1.017	0.99
100_I	119_H	1.015	0.99
53_S	57_S	1.010	0.99
61_F	65_V	1.002	0.99
64_L	71_L	0.995	0.99
61_F	93_Y	0.990	0.99
51_P	102_L	0.989	0.99
95_L	126_F	0.989	0.99
89_F	127_I	0.986	0.99
52_K	105_N	0.984	0.99
66_A	87_A	0.980	0.99
153_Y	160_K	0.957	0.99
50_R	53_S	0.954	0.99
87_A	91_I	0.953	0.99
35_I	156_G	0.947	0.99
82_F	90_L	0.940	0.99
141_I	145_Q	0.937	0.99
92_A	96_A	0.936	0.99
98_W	102_L	0.930	0.99
95_L	99_L	0.927	0.99
156_G	160_K	0.927	0.99
16_L	41_G	0.926	0.98
141_I	146_A	0.926	0.98
124_I	161_A	0.925	0.98
103_A	122_F	0.923	0.98
9_H	53_S	0.919	0.98
43_M	100_I	0.919	0.98
45_A	58_Q	0.916	0.98
37_L	40_L	0.913	0.98
170_K	174_A	0.892	0.98
102_L	106_R	0.882	0.98
170_K	173_Q	0.871	0.98
89_F	150_S	0.868	0.98
45_A	57_S	0.868	0.98
144_S	148_F	0.860	0.98
161_A	165_A	0.859	0.98
13_F	49_L	0.855	0.97
17_M	41_G	0.853	0.97
4_L	7_M	0.841	0.97
118_T	122_F	0.839	0.97
74_G	84_G	0.833	0.97
39_T	127_I	0.831	0.97
133_P	136_A	0.831	0.97
165_A	169_I	0.827	0.97
18_A	22_F	0.827	0.97
89_F	128_Y	0.827	0.97
39_T	124_I	0.806	0.96
169_I	172_T	0.806	0.96
43_M	124_I	0.804	0.96
7_M	11_A	0.790	0.96
10_I	56_L	0.788	0.96
55_F	58_Q	0.787	0.96
39_T	156_G	0.784	0.96
48_I	171_I	0.780	0.96
42_V	97_S	0.779	0.96
17_M	20_L	0.778	0.96
26_L	31_T	0.778	0.96
92_A	126_F	0.773	0.95
25_P	29_S	0.765	0.95
20_L	23_M	0.765	0.95
28_L	32_P	0.755	0.95
91_I	95_L	0.753	0.95
136_A	146_A	0.745	0.94
144_S	151_L	0.742	0.94
121_V	161_A	0.739	0.94
10_I	14_T	0.739	0.94
124_I	157_D	0.735	0.94
82_F	87_A	0.734	0.94
81_V	84_G	0.725	0.94
16_L	20_L	0.721	0.93
47_S	119_H	0.720	0.93
68_G	78_G	0.719	0.93
91_I	130_L	0.718	0.93
166_F	170_K	0.716	0.93
13_F	48_I	0.713	0.93
73_P	76_R	0.708	0.93
91_I	134_V	0.693	0.92
97_S	101_S	0.692	0.92
13_F	57_S	0.690	0.92
6_D	10_I	0.683	0.91
78_G	87_A	0.678	0.91
130_L	134_V	0.677	0.91
43_M	127_I	0.676	0.91
136_A	142_D	0.676	0.91
112_V	116_F	0.671	0.91
11_A	15_A	0.671	0.91
99_L	122_F	0.668	0.91
95_L	98_W	0.668	0.91
55_F	97_S	0.667	0.90
125_I	129_L	0.663	0.90
15_A	64_L	0.662	0.90
128_Y	132_I	0.655	0.90
150_S	154_V	0.655	0.90
112_V	115_L	0.653	0.90
18_A	69_A	0.651	0.89
102_L	105_N	0.648	0.89
140_H	144_S	0.646	0.89
26_L	35_I	0.643	0.89
86_S	90_L	0.642	0.89
139_M	149_M	0.642	0.89
133_P	137_F	0.639	0.89
46_G	100_I	0.637	0.88
82_F	91_I	0.636	0.88
33_V	135_Q	0.636	0.88
11_A	60_V	0.636	0.88
93_Y	97_S	0.633	0.88
126_F	130_L	0.628	0.88
18_A	64_L	0.627	0.88
47_S	165_A	0.625	0.87
83_F	87_A	0.623	0.87
43_M	120_I	0.617	0.87
162_A	166_F	0.613	0.86
101_S	104_A	0.611	0.86
43_M	96_A	0.610	0.86
72_L	82_F	0.609	0.86
61_F	71_L	0.602	0.85
42_V	46_G	0.597	0.85
33_V	153_Y	0.597	0.85
99_L	103_A	0.594	0.85
55_F	95_L	0.591	0.84
34_P	73_P	0.591	0.84
136_A	140_H	0.588	0.84
145_Q	148_F	0.587	0.84
96_A	126_F	0.585	0.84
122_F	126_F	0.584	0.84
121_V	125_I	0.580	0.83
86_S	152_A	0.579	0.83
139_M	145_Q	0.578	0.83
143_L	147_A	0.578	0.83
94_P	97_S	0.574	0.83
26_L	29_S	0.563	0.81
66_A	82_F	0.562	0.81
39_T	42_V	0.561	0.81
34_P	135_Q	0.561	0.81
33_V	86_S	0.558	0.81
155_P	158_L	0.558	0.81
48_I	174_A	0.557	0.81
15_A	19_V	0.555	0.81
101_S	105_N	0.554	0.80
40_L	167_L	0.554	0.80
81_V	87_A	0.553	0.80
46_G	55_F	0.551	0.80
63_L	66_A	0.550	0.80
87_A	136_A	0.549	0.80
105_N	114_R	0.545	0.79
124_I	158_L	0.544	0.79
120_I	165_A	0.539	0.79
167_L	171_I	0.539	0.79
89_F	147_A	0.534	0.78
98_W	105_N	0.534	0.78
100_I	103_A	0.534	0.78
6_D	9_H	0.533	0.78
66_A	91_I	0.533	0.78
76_R	79_F	0.525	0.77
107_L	114_R	0.523	0.76
42_V	58_Q	0.520	0.76
120_I	124_I	0.520	0.76
94_P	98_W	0.518	0.76
39_T	160_K	0.516	0.76
8_M	12_I	0.513	0.75
17_M	21_G	0.512	0.75
48_I	168_A	0.510	0.75
49_L	53_S	0.509	0.75
21_G	73_P	0.508	0.74
112_V	169_I	0.507	0.74
18_A	61_F	0.507	0.74
93_Y	127_I	0.506	0.74
117_F	165_A	0.503	0.74
31_T	149_M	0.501	0.73
17_M	57_S	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4dveA	3	0.9785	100	0.26	Contact Map
3p5nA	2	0.8602	99.8	0.601	Contact Map
4z7fA	2	0.8871	99.8	0.607	Contact Map
4huqS	1	0.8602	99.8	0.616	Contact Map
4hzuS	1	0.8495	99.8	0.636	Contact Map
4tkrA	2	0.8871	99.7	0.644	Contact Map
3rlbA	1	0.8925	99.7	0.654	Contact Map
4rfsS	1	0.8978	99.7	0.664	Contact Map
4m5bA	1	0.8817	90.9	0.898	Contact Map
4cz8A	2	0.7957	13.3	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.