CRCB2 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CRCB2 - Putative fluoride ion transporter CrcB 2

UniProt:	O07591	Sequences: MKIYSAVFIGGALGACLRYGLNLWIHTGQFPAATWLENAAGSLLLGILTGFFMIGAKRPLLSAFLGTGFCGGFTTMSTFSKETVMLLQGQPSLALLYVAASLISGIIFALIGVFVGRRIAGIQQRKGLQEK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (115)
Sequences:	4171 (3207)
Seq/√Len:	299.1

ECOLI - CRCB
BACSU - CRCB2 CRCB1
HALSA - CRCB2 CRCB1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_A	73_F	4.196	1.00
41_G	74_T	4.071	1.00
11_G	15_A	3.119	1.00
45_L	66_G	3.118	1.00
8_F	12_A	2.887	1.00
39_A	108_F	2.565	1.00
97_Y	101_S	2.550	1.00
47_I	116_G	2.297	1.00
10_G	64_F	2.293	1.00
12_A	72_G	2.275	1.00
39_A	104_S	2.049	1.00
17_L	69_F	2.041	1.00
21_L	37_E	1.953	1.00
83_T	98_V	1.919	1.00
43_L	115_V	1.879	1.00
83_T	97_Y	1.819	1.00
83_T	94_A	1.766	1.00
13_L	69_F	1.757	1.00
13_L	64_F	1.663	1.00
42_S	105_G	1.660	1.00
48_L	65_L	1.658	1.00
25_I	33_A	1.587	1.00
50_G	113_V	1.555	1.00
37_E	73_F	1.535	1.00
36_L	40_A	1.532	1.00
17_L	73_F	1.495	1.00
45_L	109_A	1.441	1.00
20_G	24_W	1.419	1.00
43_L	112_G	1.417	1.00
35_W	100_A	1.411	1.00
45_L	70_C	1.400	1.00
8_F	16_C	1.327	1.00
90_Q	93_L	1.326	1.00
16_C	20_G	1.325	1.00
85_M	88_Q	1.309	1.00
44_L	70_C	1.300	1.00
12_A	16_C	1.278	1.00
19_Y	23_L	1.276	1.00
48_L	66_G	1.272	1.00
34_T	82_E	1.264	1.00
4_Y	16_C	1.249	1.00
50_G	116_G	1.220	1.00
95_L	99_A	1.174	1.00
15_A	72_G	1.161	1.00
110_L	114_F	1.152	1.00
22_N	37_E	1.127	1.00
45_L	72_G	1.095	1.00
78_T	82_E	1.084	1.00
87_L	94_A	1.074	1.00
35_W	104_S	1.055	1.00
30_F	35_W	1.055	1.00
64_F	69_F	1.054	1.00
112_G	116_G	1.051	1.00
50_G	54_I	1.030	1.00
43_L	108_F	1.022	1.00
49_T	81_K	1.007	1.00
63_A	67_T	0.989	1.00
92_S	95_L	0.981	1.00
100_A	104_S	0.980	1.00
35_W	39_A	0.956	1.00
87_L	91_P	0.932	1.00
47_I	50_G	0.921	1.00
91_P	95_L	0.893	1.00
7_V	63_A	0.890	1.00
111_I	114_F	0.884	1.00
49_T	66_G	0.875	1.00
84_V	113_V	0.862	1.00
84_V	109_A	0.855	1.00
114_F	117_R	0.848	1.00
9_I	12_A	0.844	1.00
69_F	72_G	0.842	1.00
20_G	23_L	0.836	1.00
92_S	96_L	0.825	1.00
25_I	36_L	0.817	1.00
59_P	63_A	0.813	1.00
6_A	60_L	0.811	1.00
84_V	110_L	0.804	1.00
80_S	84_V	0.787	0.99
22_N	26_H	0.786	0.99
33_A	37_E	0.784	0.99
31_P	86_L	0.778	0.99
101_S	105_G	0.774	0.99
22_N	82_E	0.770	0.99
62_S	66_G	0.769	0.99
79_F	105_G	0.765	0.99
61_L	64_F	0.751	0.99
57_K	61_L	0.749	0.99
108_F	111_I	0.746	0.99
110_L	113_V	0.746	0.99
22_N	34_T	0.744	0.99
96_L	100_A	0.733	0.99
82_E	85_M	0.729	0.99
43_L	50_G	0.729	0.99
32_A	36_L	0.710	0.99
100_A	103_I	0.706	0.99
94_A	102_L	0.705	0.99
113_V	117_R	0.704	0.99
51_F	116_G	0.704	0.99
106_I	109_A	0.692	0.99
52_F	55_G	0.692	0.99
9_I	64_F	0.690	0.99
17_L	20_G	0.688	0.99
23_L	27_T	0.688	0.99
114_F	118_R	0.688	0.99
99_A	103_I	0.685	0.99
6_A	64_F	0.680	0.98
37_E	40_A	0.679	0.98
79_F	98_V	0.679	0.98
21_L	36_L	0.677	0.98
52_F	57_K	0.668	0.98
76_M	80_S	0.664	0.98
104_S	108_F	0.664	0.98
4_Y	63_A	0.660	0.98
29_Q	96_L	0.657	0.98
60_L	63_A	0.654	0.98
50_G	53_M	0.654	0.98
69_F	73_F	0.650	0.98
17_L	21_L	0.647	0.98
47_I	115_V	0.643	0.98
15_A	70_C	0.642	0.98
63_A	66_G	0.639	0.98
86_L	97_Y	0.636	0.98
35_W	101_S	0.636	0.98
29_Q	93_L	0.635	0.98
81_K	85_M	0.633	0.98
48_L	52_F	0.627	0.97
51_F	55_G	0.622	0.97
58_R	61_L	0.615	0.97
13_L	16_C	0.614	0.97
26_H	33_A	0.607	0.97
54_I	117_R	0.604	0.97
10_G	79_F	0.601	0.97
80_S	102_L	0.601	0.97
48_L	57_K	0.597	0.97
7_V	10_G	0.594	0.96
21_L	25_I	0.593	0.96
10_G	69_F	0.590	0.96
34_T	75_T	0.590	0.96
80_S	83_T	0.589	0.96
107_I	111_I	0.587	0.96
21_L	33_A	0.583	0.96
28_G	32_A	0.582	0.96
30_F	86_L	0.579	0.96
28_G	93_L	0.578	0.96
21_L	73_F	0.571	0.96
29_Q	95_L	0.569	0.95
4_Y	49_T	0.568	0.95
46_G	109_A	0.566	0.95
42_S	109_A	0.565	0.95
44_L	65_L	0.559	0.95
80_S	109_A	0.556	0.95
60_L	64_F	0.555	0.95
93_L	96_L	0.554	0.95
35_W	93_L	0.547	0.94
98_V	102_L	0.546	0.94
4_Y	20_G	0.541	0.94
49_T	113_V	0.538	0.94
42_S	45_L	0.535	0.94
47_I	51_F	0.530	0.93
45_L	49_T	0.529	0.93
49_T	53_M	0.529	0.93
61_L	65_L	0.523	0.93
84_V	88_Q	0.523	0.93
72_G	76_M	0.517	0.93
59_P	62_S	0.515	0.92
21_L	40_A	0.514	0.92
66_G	78_T	0.514	0.92
72_G	79_F	0.510	0.92
42_S	70_C	0.505	0.92
108_F	116_G	0.505	0.92
53_M	113_V	0.502	0.91
7_V	89_G	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pypA	1	0.9313	28	0.909	Contact Map
4p6vD	1	0.8321	27.4	0.909	Contact Map
4j05A	3	0.9771	20.3	0.914	Contact Map
3rlbA	1	0.9618	14.7	0.92	Contact Map
4eneA	2	0.9313	9.5	0.926	Contact Map
3j1zP	8	0.8779	9.3	0.927	Contact Map
2b2hA	3	1	8.5	0.928	Contact Map
4w6vA	1	0.9084	7.8	0.929	Contact Map
3effK	4	0.8015	7.7	0.929	Contact Map
2kluA	1	0.3282	7.4	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.