CRCB1 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CRCB1 - Putative fluoride ion transporter CrcB 1

UniProt:	O07590	Sequences: MTLAGIFIGGGLGAMLRFWLGNVITAKTKGLSLPIGILTVNILGALGLGIFTGLHVANASVSLIIGTGFFGAFTTFSTFSVETIQLLMAKRVKESILYIVLTLCGSLFAFWCGWTITI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	118 (112)
Sequences:	2859 (2162)
Seq/√Len:	204.3

ECOLI - CRCB
BACSU - CRCB1 CRCB2
HALSA - CRCB1 CRCB2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
44_G	74_T	4.557	1.00
43_L	73_F	4.028	1.00
7_F	11_G	3.539	1.00
10_G	14_A	3.383	1.00
48_L	66_G	3.122	1.00
98_Y	102_T	2.625	1.00
42_I	109_A	2.594	1.00
9_G	64_I	2.551	1.00
16_L	69_F	2.318	1.00
11_G	72_A	2.221	1.00
12_L	64_I	2.085	1.00
45_A	106_S	1.931	1.00
42_I	105_G	1.895	1.00
38_L	101_L	1.827	1.00
40_V	73_F	1.790	1.00
83_T	99_I	1.713	1.00
53_G	114_W	1.648	1.00
48_L	70_F	1.576	1.00
20_L	40_V	1.565	1.00
51_F	65_I	1.559	1.00
47_G	70_F	1.547	1.00
83_T	95_S	1.544	1.00
48_L	110_F	1.526	1.00
39_T	43_L	1.514	1.00
12_L	69_F	1.441	1.00
14_A	72_A	1.404	1.00
91_R	94_E	1.397	1.00
16_L	73_F	1.389	1.00
15_M	19_W	1.374	1.00
83_T	98_Y	1.374	1.00
51_F	66_G	1.358	1.00
46_L	116_I	1.335	1.00
30_G	35_I	1.333	1.00
24_I	36_G	1.306	1.00
64_I	69_F	1.305	1.00
48_L	72_A	1.296	1.00
63_L	67_T	1.284	1.00
96_I	100_V	1.225	1.00
18_F	22_N	1.214	1.00
50_I	54_L	1.205	1.00
111_W	115_T	1.166	1.00
84_I	114_W	1.154	1.00
46_L	109_A	1.144	1.00
85_Q	88_M	1.135	1.00
78_T	82_E	1.133	1.00
7_F	15_M	1.120	1.00
52_T	81_V	1.119	1.00
84_I	110_F	1.102	1.00
19_W	23_V	1.096	1.00
53_G	57_A	1.090	1.00
52_T	56_V	1.035	1.00
82_E	85_Q	1.019	1.00
101_L	105_G	1.014	1.00
93_K	96_I	1.013	1.00
87_L	95_S	1.005	1.00
52_T	66_G	0.983	1.00
80_S	110_F	0.961	0.99
36_G	40_V	0.958	0.99
19_W	22_N	0.947	0.99
38_L	42_I	0.935	0.99
21_G	40_V	0.922	0.99
38_L	105_G	0.918	0.99
14_A	70_F	0.908	0.99
6_I	63_L	0.903	0.99
102_T	106_S	0.889	0.99
24_I	39_T	0.884	0.99
40_V	43_L	0.880	0.99
11_G	15_M	0.876	0.99
3_L	15_M	0.874	0.99
93_K	97_L	0.861	0.99
21_G	82_E	0.839	0.99
112_C	115_T	0.838	0.99
4_A	8_I	0.827	0.98
46_L	113_G	0.821	0.98
69_F	73_F	0.808	0.98
5_G	60_S	0.794	0.98
3_L	63_L	0.794	0.98
46_L	53_G	0.788	0.98
105_G	109_A	0.786	0.98
109_A	112_C	0.783	0.98
62_S	66_G	0.776	0.98
24_I	29_K	0.775	0.98
108_F	112_C	0.775	0.98
3_L	52_T	0.774	0.98
29_K	32_S	0.754	0.97
21_G	25_T	0.746	0.97
20_L	24_I	0.745	0.97
35_I	39_T	0.742	0.97
33_L	86_L	0.738	0.97
80_S	103_L	0.726	0.97
95_S	103_L	0.717	0.96
9_G	79_F	0.711	0.96
63_L	66_G	0.709	0.96
104_C	108_F	0.700	0.96
61_V	64_I	0.699	0.96
45_A	70_F	0.690	0.95
33_L	38_L	0.684	0.95
47_G	65_I	0.676	0.95
17_R	68_G	0.676	0.95
94_E	98_Y	0.668	0.94
92_V	96_I	0.668	0.94
79_F	106_S	0.661	0.94
79_F	103_L	0.654	0.94
54_L	58_N	0.653	0.94
61_V	65_I	0.650	0.94
53_G	56_V	0.649	0.94
55_H	58_N	0.649	0.94
49_G	76_F	0.647	0.93
50_I	113_G	0.643	0.93
66_G	78_T	0.641	0.93
24_I	28_T	0.633	0.93
100_V	104_C	0.629	0.93
20_L	43_L	0.625	0.92
67_T	78_T	0.625	0.92
6_I	90_K	0.622	0.92
29_K	35_I	0.622	0.92
34_P	86_L	0.621	0.92
47_G	51_F	0.620	0.92
38_L	106_S	0.616	0.92
25_T	36_G	0.614	0.92
55_H	66_G	0.609	0.91
50_I	53_G	0.609	0.91
51_F	55_H	0.609	0.91
37_I	41_N	0.600	0.91
111_W	114_W	0.599	0.91
25_T	28_T	0.594	0.90
20_L	39_T	0.593	0.90
10_G	98_Y	0.593	0.90
110_F	113_G	0.590	0.90
101_L	104_C	0.586	0.90
72_A	79_F	0.584	0.89
38_L	102_T	0.584	0.89
16_L	19_W	0.583	0.89
96_I	107_L	0.583	0.89
45_A	110_F	0.583	0.89
37_I	82_E	0.582	0.89
45_A	107_L	0.579	0.89
49_G	64_I	0.575	0.89
23_V	87_L	0.571	0.88
107_L	110_F	0.569	0.88
79_F	99_I	0.567	0.88
23_V	28_T	0.561	0.88
108_F	111_W	0.561	0.88
80_S	84_I	0.560	0.87
72_A	76_F	0.559	0.87
32_S	91_R	0.555	0.87
37_I	75_T	0.555	0.87
81_V	85_Q	0.553	0.87
88_M	114_W	0.550	0.87
6_I	9_G	0.548	0.86
25_T	29_K	0.547	0.86
20_L	73_F	0.546	0.86
42_I	46_L	0.546	0.86
97_L	101_L	0.543	0.86
81_V	110_F	0.542	0.86
89_A	92_V	0.536	0.85
56_V	114_W	0.529	0.84
24_I	40_V	0.528	0.84
86_L	98_Y	0.522	0.84
45_A	80_S	0.519	0.83
98_Y	106_S	0.517	0.83
49_G	110_F	0.510	0.82
60_S	63_L	0.509	0.82
5_G	64_I	0.509	0.82
66_G	81_V	0.509	0.82
90_K	95_S	0.502	0.81
22_N	25_T	0.501	0.81
87_L	92_V	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q65A	1	0.9831	11.3	0.915	Contact Map
4uvmA	1	0.9831	9.3	0.918	Contact Map
4j05A	3	0.9576	7.8	0.921	Contact Map
4tphA	2	0.9661	7.2	0.922	Contact Map
4ikvA	1	0.9831	6.5	0.923	Contact Map
4xnjA	1	0.9831	4.7	0.928	Contact Map
4pypA	1	0.9831	4.7	0.928	Contact Map
2cfqA	1	0.9576	4.4	0.929	Contact Map
4xp4A	1	0.9831	4.3	0.93	Contact Map
4oh3A	2	0.9831	4.2	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.