CUER - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CUER - HTH-type transcriptional regulator CueR

UniProt:	O07586	Sequences: MVGRDIDGAETYRISELAALAGVTKRTVDYYTNLGLLTPARSCSNYRYYDENALKRLIFIVDCKKQRLALSDIKDRLENQFPSSAKLDDEIGNLALEIDHMNQNISGILHRFERLKPEDRDKLKSKLPPEKLAVFQSFMLLLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (116)
Sequences:	12404 (8720)
Seq/√Len:	809.6

ECOLI - SOXR ZNTR CUER
BACSU - CUER ADHR MTA BLTR YYAN YDFL YFMP BMRR GLNR TNRA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_N	112_F	4.083	1.00
50_D	53_A	3.184	1.00
105_I	109_L	3.111	1.00
98_I	116_K	3.094	1.00
30_Y	34_L	2.763	1.00
95_A	119_D	2.722	1.00
26_R	33_N	2.479	1.00
97_E	100_H	2.237	1.00
25_K	29_D	2.099	1.00
42_S	48_Y	1.900	1.00
64_K	70_L	1.751	1.00
105_I	108_I	1.739	1.00
34_L	74_K	1.737	1.00
98_I	112_F	1.673	1.00
17_L	54_L	1.667	1.00
15_S	19_A	1.653	1.00
109_L	112_F	1.605	1.00
61_V	64_K	1.596	1.00
95_A	123_L	1.583	1.00
98_I	102_N	1.580	1.00
104_N	107_G	1.572	1.00
17_L	57_L	1.563	1.00
91_I	95_A	1.559	1.00
69_A	72_D	1.558	1.00
112_F	116_K	1.557	1.00
103_Q	107_G	1.497	1.00
102_N	116_K	1.497	1.00
94_L	119_D	1.428	1.00
98_I	119_D	1.421	1.00
91_I	123_L	1.401	1.00
56_R	77_L	1.392	1.00
100_H	104_N	1.377	1.00
16_E	19_A	1.349	1.00
36_L	60_I	1.348	1.00
14_I	29_D	1.347	1.00
102_N	105_I	1.293	1.00
56_R	81_F	1.276	1.00
13_R	16_E	1.263	1.00
72_D	97_E	1.260	1.00
13_R	48_Y	1.257	1.00
106_S	109_L	1.193	1.00
21_A	57_L	1.178	1.00
17_L	53_A	1.158	1.00
24_T	27_T	1.140	1.00
65_K	107_G	1.138	1.00
108_I	112_F	1.097	1.00
74_K	78_E	1.091	1.00
16_E	20_L	1.089	1.00
105_I	112_F	1.064	1.00
20_L	54_L	1.061	1.00
106_S	110_H	1.056	1.00
99_D	103_Q	1.040	1.00
28_V	49_Y	1.016	1.00
60_I	73_I	1.012	1.00
13_R	46_Y	1.011	1.00
27_T	30_Y	1.007	1.00
89_D	92_G	1.000	1.00
101_M	105_I	0.997	1.00
67_R	104_N	0.994	1.00
117_P	121_D	0.986	1.00
102_N	106_S	0.983	1.00
34_L	71_S	0.973	1.00
12_Y	48_Y	0.972	1.00
61_V	65_K	0.959	1.00
12_Y	51_E	0.949	1.00
80_Q	83_S	0.949	1.00
41_R	44_S	0.949	1.00
28_V	57_L	0.944	1.00
101_M	108_I	0.927	1.00
31_Y	57_L	0.925	1.00
104_N	108_I	0.923	1.00
40_A	53_A	0.916	1.00
21_A	54_L	0.915	1.00
100_H	103_Q	0.915	1.00
32_T	38_T	0.908	1.00
103_Q	106_S	0.888	1.00
30_Y	70_L	0.883	1.00
18_A	25_K	0.881	1.00
99_D	102_N	0.880	1.00
92_G	96_L	0.878	1.00
15_S	25_K	0.869	1.00
72_D	75_D	0.868	1.00
12_Y	20_L	0.867	1.00
94_L	115_L	0.859	1.00
40_A	49_Y	0.843	1.00
82_P	85_A	0.840	1.00
42_S	46_Y	0.840	1.00
97_E	104_N	0.834	1.00
71_S	74_K	0.822	1.00
23_V	57_L	0.819	1.00
32_T	37_L	0.811	1.00
20_L	58_I	0.807	1.00
51_E	55_K	0.804	1.00
107_G	110_H	0.784	1.00
66_Q	111_R	0.777	1.00
37_L	60_I	0.773	1.00
59_F	63_C	0.769	1.00
37_L	53_A	0.768	1.00
18_A	28_V	0.763	1.00
93_N	96_L	0.756	1.00
86_K	89_D	0.739	1.00
40_A	50_D	0.736	1.00
88_D	126_K	0.733	1.00
101_M	115_L	0.728	1.00
96_L	100_H	0.721	1.00
14_I	18_A	0.720	1.00
96_L	99_D	0.720	1.00
32_T	49_Y	0.718	1.00
20_L	51_E	0.717	1.00
26_R	30_Y	0.715	1.00
95_A	98_I	0.713	1.00
72_D	96_L	0.712	1.00
79_N	83_S	0.701	1.00
121_D	124_K	0.693	1.00
68_L	76_R	0.689	1.00
54_L	58_I	0.684	1.00
57_L	64_K	0.682	1.00
109_L	113_E	0.673	1.00
95_A	99_D	0.666	1.00
91_I	119_D	0.666	1.00
75_D	78_E	0.664	1.00
113_E	117_P	0.662	1.00
28_V	32_T	0.660	1.00
35_G	38_T	0.652	1.00
121_D	125_S	0.649	1.00
72_D	100_H	0.646	1.00
55_K	58_I	0.638	1.00
58_I	62_D	0.637	1.00
52_N	55_K	0.634	1.00
92_G	95_A	0.633	1.00
63_C	68_L	0.628	1.00
23_V	27_T	0.626	1.00
21_A	28_V	0.626	1.00
23_V	61_V	0.625	1.00
11_T	48_Y	0.624	1.00
44_S	48_Y	0.624	1.00
117_P	120_R	0.623	1.00
42_S	45_N	0.620	1.00
24_T	30_Y	0.620	1.00
17_L	37_L	0.613	1.00
75_D	89_D	0.609	1.00
101_M	111_R	0.608	1.00
79_N	82_P	0.608	1.00
58_I	61_V	0.601	1.00
53_A	56_R	0.596	1.00
27_T	64_K	0.593	1.00
90_E	94_L	0.589	1.00
102_N	109_L	0.588	1.00
30_Y	33_N	0.581	1.00
68_L	72_D	0.571	1.00
110_H	113_E	0.566	1.00
116_K	120_R	0.563	1.00
121_D	126_K	0.554	1.00
34_L	70_L	0.550	1.00
65_K	114_R	0.544	1.00
88_D	92_G	0.542	1.00
21_A	25_K	0.537	1.00
90_E	122_K	0.534	1.00
64_K	73_I	0.532	1.00
32_T	39_P	0.531	1.00
118_E	121_D	0.525	1.00
26_R	59_F	0.524	1.00
41_R	47_R	0.522	1.00
17_L	21_A	0.522	1.00
107_G	111_R	0.521	1.00
123_L	126_K	0.521	1.00
21_A	61_V	0.516	1.00
93_N	97_E	0.511	1.00
101_M	112_F	0.507	1.00
11_T	40_A	0.506	1.00
80_Q	84_S	0.506	1.00
111_R	114_R	0.503	1.00
63_C	76_R	0.503	1.00
120_R	123_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zhgA	2	0.8462	100	0.228	Contact Map
1q06A	2	0.8811	100	0.238	Contact Map
2dg6A	2	0.8462	100	0.24	Contact Map
3gp4A	4	0.9161	99.9	0.258	Contact Map
3hh0A	4	0.9021	99.9	0.259	Contact Map
4ua1A	2	0.8671	99.9	0.272	Contact Map
3gpvA	2	0.8042	99.9	0.28	Contact Map
3qaoA	2	0.8951	99.9	0.289	Contact Map
2vz4A	2	0.6923	99.9	0.319	Contact Map
1r8dA	2	0.7552	99.9	0.326	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.