YHJQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHJQ - Uncharacterized cysteine-rich protein YhjQ

UniProt:	O07571	Sequences: MEQYSEACIEACIDCMKACNHCFTKCLEESVQHHLSGCIRLDRECADICALAVKAMQTDSPFMKEICALCADICEACGTECGKHDHDHCQACAKACFTCAEQCRSMAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	108 (104)
Sequences:	750 (557)
Seq/√Len:	54.6

BACSU - YHJQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_C	12_C	4.019	1.00
13_I	53_V	3.327	1.00
75_E	104_R	3.187	1.00
44_E	58_T	2.354	1.00
47_D	54_K	2.291	1.00
65_E	72_D	2.256	1.00
101_E	105_S	2.147	1.00
82_G	97_F	2.138	1.00
75_E	100_A	2.076	1.00
56_M	106_M	1.927	1.00
67_C	106_M	1.907	1.00
6_E	10_E	1.895	1.00
71_A	104_R	1.856	0.99
78_G	97_F	1.851	0.99
37_G	40_R	1.813	0.99
52_A	56_M	1.811	0.99
94_K	98_T	1.787	0.99
48_I	73_I	1.749	0.99
75_E	78_G	1.612	0.98
31_V	34_H	1.607	0.98
20_N	43_R	1.587	0.98
75_E	79_T	1.564	0.98
7_A	102_Q	1.418	0.96
87_D	91_A	1.413	0.96
79_T	82_G	1.380	0.96
52_A	67_C	1.365	0.95
8_C	106_M	1.346	0.95
15_C	45_C	1.319	0.94
8_C	67_C	1.286	0.94
68_A	72_D	1.284	0.94
22_C	88_H	1.244	0.93
50_A	54_K	1.230	0.92
102_Q	105_S	1.228	0.92
79_T	97_F	1.223	0.92
12_C	67_C	1.209	0.91
24_T	40_R	1.189	0.91
42_D	95_A	1.163	0.90
52_A	66_I	1.156	0.90
43_R	47_D	1.149	0.89
48_I	66_I	1.148	0.89
55_A	66_I	1.148	0.89
65_E	69_L	1.146	0.89
22_C	38_C	1.144	0.89
16_M	23_F	1.135	0.89
45_C	49_C	1.113	0.88
68_A	104_R	1.098	0.87
20_N	44_E	1.090	0.87
29_E	88_H	1.086	0.86
10_E	14_D	1.083	0.86
99_C	103_C	1.077	0.86
15_C	49_C	1.076	0.86
17_K	57_Q	1.076	0.86
11_A	14_D	1.051	0.84
47_D	58_T	1.034	0.83
33_H	36_S	1.031	0.83
62_F	76_A	1.008	0.82
9_I	56_M	1.008	0.82
20_N	50_A	1.000	0.81
78_G	82_G	0.990	0.81
44_E	60_S	0.976	0.80
30_S	33_H	0.943	0.77
38_C	80_E	0.929	0.76
52_A	106_M	0.923	0.76
5_S	63_M	0.883	0.73
28_E	59_D	0.877	0.72
80_E	83_K	0.863	0.71
48_I	51_L	0.859	0.71
8_C	56_M	0.853	0.70
16_M	50_A	0.850	0.70
12_C	71_A	0.849	0.70
32_Q	36_S	0.845	0.69
49_C	96_C	0.836	0.68
27_L	39_I	0.835	0.68
35_L	86_H	0.830	0.68
55_A	60_S	0.825	0.67
16_M	20_N	0.815	0.66
82_G	90_Q	0.801	0.65
22_C	89_C	0.795	0.65
62_F	73_I	0.790	0.64
87_D	90_Q	0.784	0.63
84_H	88_H	0.784	0.63
13_I	16_M	0.778	0.63
20_N	55_A	0.778	0.63
91_A	94_K	0.766	0.62
22_C	93_A	0.763	0.61
11_A	98_T	0.758	0.61
44_E	55_A	0.758	0.61
35_L	85_D	0.758	0.61
7_A	11_A	0.754	0.60
18_A	91_A	0.753	0.60
15_C	19_C	0.752	0.60
23_F	84_H	0.749	0.60
66_I	69_L	0.748	0.60
64_K	78_G	0.744	0.59
79_T	83_K	0.742	0.59
37_G	41_L	0.742	0.59
22_C	80_E	0.742	0.59
12_C	56_M	0.739	0.59
26_C	93_A	0.734	0.58
8_C	11_A	0.733	0.58
23_F	44_E	0.732	0.58
12_C	106_M	0.718	0.57
75_E	97_F	0.715	0.56
72_D	76_A	0.714	0.56
47_D	51_L	0.707	0.55
22_C	84_H	0.702	0.55
38_C	89_C	0.702	0.55
47_D	50_A	0.688	0.53
29_E	42_D	0.678	0.52
35_L	42_D	0.670	0.52
82_G	94_K	0.664	0.51
45_C	96_C	0.656	0.50
25_K	89_C	0.645	0.49
51_L	55_A	0.641	0.48
76_A	83_K	0.639	0.48
67_C	71_A	0.639	0.48
11_A	95_A	0.635	0.48
100_A	104_R	0.631	0.47
68_A	107_A	0.630	0.47
42_D	52_A	0.621	0.46
35_L	38_C	0.620	0.46
69_L	72_D	0.619	0.46
23_F	55_A	0.617	0.46
38_C	88_H	0.615	0.46
11_A	102_Q	0.609	0.45
85_D	90_Q	0.607	0.45
56_M	67_C	0.593	0.43
37_G	59_D	0.583	0.42
30_S	36_S	0.572	0.41
54_K	58_T	0.568	0.41
16_M	53_V	0.554	0.39
9_I	101_E	0.553	0.39
20_N	47_D	0.552	0.39
24_T	28_E	0.548	0.39
35_L	84_H	0.543	0.38
98_T	101_E	0.539	0.38
63_M	66_I	0.536	0.37
25_K	29_E	0.531	0.37
12_C	53_V	0.528	0.37
77_C	81_C	0.527	0.37
15_C	96_C	0.525	0.36
71_A	100_A	0.524	0.36
9_I	57_Q	0.524	0.36
22_C	26_C	0.523	0.36
5_S	56_M	0.523	0.36
23_F	43_R	0.520	0.36
42_D	84_H	0.519	0.36
19_C	49_C	0.518	0.36
23_F	42_D	0.511	0.35
41_L	76_A	0.510	0.35
71_A	82_G	0.509	0.35
5_S	8_C	0.506	0.35
18_A	95_A	0.503	0.34
13_I	57_Q	0.503	0.34
19_C	45_C	0.500	0.34
18_A	29_E	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lmfA	4	0.9815	100	0.157	Contact Map
3kawA	2	0.8796	100	0.248	Contact Map
5c4iB	1	0.5648	17.7	0.921	Contact Map
1ti6B	2	0.8796	17.4	0.922	Contact Map
1h0hB	1	0.9167	8.2	0.933	Contact Map
2ivfB	1	0.9074	7.7	0.933	Contact Map
4r0vA	1	0	7.2	0.934	Contact Map
1q16B	2	0.7963	7.2	0.934	Contact Map
4z3xE	2	0.6667	6.3	0.936	Contact Map
1kqfB	3	0.9444	5.1	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.