KHTT - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KHTT - K(+)/H(+) antiporter subunit KhtT

UniProt:	O07535	Sequences: MNIKENDLPGIGKKFEIETRSHEKMTIIIHDDGRREIYRFNDRDPDELLSNISLDDSEARQIAAILGGMVYKPQALESIEMAFSDLIIEWFKVEKGAKSIGRTLGELDVRQNYDVTVIAIIKHNQEKLLNPGADSIIEENDTLVLSGERKHLKKLIHDFLSGEGV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	165 (153)
Sequences:	2316 (1831)
Seq/√Len:	148.0

ECOLI - TRKA
BACSU - KHTT YRVC KTRC KTRA YJBQ
HALSA - Q9HRN5 Q9HSL4 Q9HQ83 Q9HNV8 Q9HHY1 Q9HNK1 Q9HHU4 Q9HHU8 Q9HHS7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
120_I	135_S	4.900	1.00
122_K	141_D	4.659	1.00
93_V	137_I	4.030	1.00
21_S	24_K	3.636	1.00
31_D	39_R	2.789	1.00
7_D	12_G	2.521	1.00
104_L	117_V	2.282	1.00
59_A	62_I	2.247	1.00
102_R	106_E	2.233	1.00
105_G	134_D	2.215	1.00
103_T	106_E	2.189	1.00
108_D	111_Q	2.161	1.00
99_S	107_L	2.114	1.00
17_I	30_H	2.106	1.00
17_I	37_I	2.052	1.00
103_T	136_I	2.050	1.00
30_H	33_G	1.988	1.00
63_A	67_G	1.979	1.00
20_R	26_T	1.886	1.00
100_I	139_E	1.859	1.00
59_A	63_A	1.838	1.00
67_G	70_V	1.807	1.00
95_K	139_E	1.786	1.00
122_K	138_E	1.762	1.00
148_E	151_H	1.751	1.00
113_Y	151_H	1.724	1.00
90_W	144_V	1.616	1.00
9_P	14_K	1.613	1.00
22_H	25_M	1.611	1.00
122_K	135_S	1.557	1.00
114_D	151_H	1.523	1.00
62_I	67_G	1.521	1.00
10_G	13_K	1.505	1.00
28_I	31_D	1.484	1.00
31_D	34_R	1.479	1.00
59_A	65_I	1.474	1.00
109_V	155_L	1.469	1.00
34_R	37_I	1.454	1.00
137_I	143_L	1.435	1.00
51_N	54_L	1.434	1.00
69_M	73_P	1.409	1.00
118_I	146_S	1.389	1.00
20_R	24_K	1.377	1.00
61_Q	65_I	1.366	1.00
101_G	138_E	1.363	1.00
120_I	141_D	1.341	1.00
66_L	73_P	1.304	1.00
110_R	116_T	1.296	1.00
63_A	66_L	1.287	1.00
30_H	34_R	1.266	1.00
72_K	75_A	1.247	1.00
65_I	73_P	1.245	1.00
93_V	100_I	1.207	1.00
145_L	155_L	1.197	1.00
101_G	139_E	1.187	1.00
119_A	144_V	1.183	1.00
73_P	76_L	1.173	1.00
31_D	57_S	1.156	1.00
38_Y	41_N	1.152	1.00
130_N	133_A	1.145	1.00
117_V	145_L	1.134	0.99
11_I	17_I	1.126	0.99
88_I	146_S	1.116	0.99
104_L	131_P	1.113	0.99
108_D	112_N	1.110	0.99
42_D	47_E	1.083	0.99
39_R	43_R	1.077	0.99
48_L	52_I	1.058	0.99
68_G	72_K	1.056	0.99
138_E	141_D	1.029	0.99
48_L	55_D	1.014	0.99
61_Q	67_G	1.013	0.99
96_G	100_I	1.009	0.99
51_N	55_D	1.000	0.99
21_S	27_I	0.991	0.99
116_T	133_A	0.990	0.99
109_V	115_V	0.988	0.99
35_R	41_N	0.981	0.99
62_I	66_L	0.976	0.98
52_I	56_D	0.968	0.98
62_I	69_M	0.964	0.98
69_M	72_K	0.950	0.98
109_V	117_V	0.948	0.98
21_S	25_M	0.947	0.98
41_N	45_P	0.940	0.98
68_G	71_Y	0.938	0.98
52_I	55_D	0.922	0.98
51_N	57_S	0.915	0.98
20_R	23_E	0.911	0.98
65_I	69_M	0.904	0.97
119_A	128_L	0.902	0.97
28_I	32_D	0.898	0.97
103_T	107_L	0.877	0.97
109_V	113_Y	0.865	0.97
39_R	42_D	0.863	0.97
105_G	132_G	0.852	0.96
153_K	156_I	0.839	0.96
79_I	88_I	0.834	0.96
66_L	70_V	0.825	0.96
51_N	56_D	0.823	0.96
110_R	113_Y	0.821	0.96
9_P	30_H	0.818	0.95
78_S	81_M	0.816	0.95
91_F	145_L	0.815	0.95
29_I	37_I	0.810	0.95
61_Q	68_G	0.808	0.95
67_G	73_P	0.805	0.95
84_S	87_I	0.803	0.95
70_V	73_P	0.801	0.95
40_F	43_R	0.800	0.95
122_K	128_L	0.800	0.95
6_N	9_P	0.793	0.95
62_I	73_P	0.793	0.95
52_I	58_E	0.783	0.94
62_I	65_I	0.779	0.94
45_P	54_L	0.779	0.94
87_I	149_R	0.777	0.94
20_R	25_M	0.775	0.94
39_R	56_D	0.764	0.93
35_R	40_F	0.763	0.93
62_I	115_V	0.762	0.93
27_I	62_I	0.761	0.93
49_L	56_D	0.761	0.93
110_R	152_L	0.759	0.93
43_R	46_D	0.754	0.93
43_R	51_N	0.752	0.93
99_S	155_L	0.749	0.93
147_G	151_H	0.740	0.92
126_E	154_K	0.735	0.92
128_L	135_S	0.732	0.92
65_I	71_Y	0.728	0.92
90_W	142_T	0.724	0.92
55_D	58_E	0.715	0.91
21_S	26_T	0.709	0.91
115_V	145_L	0.704	0.90
63_A	73_P	0.700	0.90
95_K	140_N	0.700	0.90
86_L	146_S	0.698	0.90
123_H	126_E	0.691	0.90
61_Q	66_L	0.689	0.89
59_A	69_M	0.687	0.89
38_Y	44_D	0.687	0.89
135_S	138_E	0.686	0.89
71_Y	74_Q	0.686	0.89
41_N	47_E	0.676	0.89
61_Q	73_P	0.669	0.88
15_F	18_E	0.661	0.87
110_R	133_A	0.659	0.87
6_N	14_K	0.656	0.87
50_S	53_S	0.652	0.87
69_M	75_A	0.651	0.87
42_D	137_I	0.648	0.86
75_A	155_L	0.647	0.86
19_T	41_N	0.646	0.86
59_A	66_L	0.646	0.86
33_G	36_E	0.633	0.85
59_A	67_G	0.623	0.84
50_S	55_D	0.622	0.84
43_R	47_E	0.617	0.84
60_R	66_L	0.616	0.83
104_L	108_D	0.615	0.83
59_A	70_V	0.611	0.83
101_G	136_I	0.607	0.83
89_E	130_N	0.606	0.82
31_D	35_R	0.605	0.82
86_L	118_I	0.605	0.82
65_I	68_G	0.602	0.82
23_E	144_V	0.597	0.82
50_S	54_L	0.597	0.82
29_I	58_E	0.594	0.81
5_E	9_P	0.593	0.81
14_K	23_E	0.593	0.81
35_R	42_D	0.592	0.81
16_E	144_V	0.592	0.81
78_S	82_A	0.591	0.81
23_E	44_D	0.589	0.81
60_R	69_M	0.587	0.80
29_I	34_R	0.587	0.80
7_D	33_G	0.585	0.80
29_I	32_D	0.582	0.80
38_Y	42_D	0.581	0.80
121_I	142_T	0.575	0.79
37_I	44_D	0.573	0.79
73_P	78_S	0.572	0.79
54_L	58_E	0.569	0.78
94_E	139_E	0.563	0.78
36_E	40_F	0.563	0.78
66_L	74_Q	0.562	0.78
29_I	41_N	0.561	0.77
66_L	76_L	0.560	0.77
16_E	24_K	0.557	0.77
37_I	42_D	0.553	0.76
30_H	35_R	0.550	0.76
59_A	74_Q	0.549	0.76
22_H	144_V	0.549	0.76
63_A	69_M	0.547	0.76
33_G	46_D	0.547	0.76
34_R	38_Y	0.546	0.76
14_K	41_N	0.545	0.75
153_K	157_H	0.544	0.75
58_E	104_L	0.544	0.75
115_V	155_L	0.542	0.75
94_E	112_N	0.541	0.75
60_R	68_G	0.538	0.74
37_I	40_F	0.537	0.74
30_H	37_I	0.533	0.74
68_G	73_P	0.532	0.74
105_G	109_V	0.532	0.74
80_E	87_I	0.528	0.73
40_F	45_P	0.524	0.73
114_D	143_L	0.522	0.72
39_R	47_E	0.521	0.72
49_L	52_I	0.520	0.72
50_S	56_D	0.520	0.72
34_R	39_R	0.520	0.72
87_I	116_T	0.518	0.72
5_E	35_R	0.518	0.72
102_R	112_N	0.517	0.72
19_T	27_I	0.514	0.71
54_L	57_S	0.513	0.71
23_E	26_T	0.513	0.71
154_K	157_H	0.513	0.71
147_G	155_L	0.508	0.70
107_L	135_S	0.508	0.70
105_G	133_A	0.506	0.70
60_R	67_G	0.504	0.70
63_A	70_V	0.503	0.69
115_V	151_H	0.502	0.69
126_E	150_K	0.502	0.69
17_I	20_R	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2aefA	2	0.9879	99.9	0.412	Contact Map
1lnqA	6	0.9697	99.9	0.42	Contact Map
4gx0A	3	0.9394	99.9	0.423	Contact Map
3mt5A	5	0.9333	99.8	0.441	Contact Map
3nafA	3	0.9515	99.8	0.449	Contact Map
4g65A	2	0.9636	99.8	0.461	Contact Map
4hpfA	3	0.9273	99.8	0.468	Contact Map
3l4bC	2	0.9394	99.8	0.484	Contact Map
4j91A	3	0.9394	99.6	0.547	Contact Map
1vctA	3	0.8848	99.6	0.554	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.