YHAJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHAJ - Uncharacterized membrane protein YhaJ

UniProt:	O07518	Sequences: MNCWKTINLMKDYGAVRIILTAVCFMILVFISTFLAFELLRPGTSLSDEYVSLFGGLLVVILFVHKVIHVLPIICKKRKIEKKFYILRMRTWKRIPKTTMLISLVSPFLLITPVLFYAALAFPNHAHYFCMISGIHAGYCLPDFLLALKLIKAPKTAFIDQEADGLDILVEK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (169)
Sequences:	119 (97)
Seq/√Len:	7.4

BACSU - YHAJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
127_H	161_Q	2.917	0.84
18_I	151_I	2.760	0.80
149_K	152_K	2.597	0.76
108_F	144_F	2.406	0.70
21_T	144_F	2.398	0.69
4_W	168_I	2.266	0.65
108_F	140_C	2.262	0.64
74_I	77_K	2.220	0.63
55_G	139_Y	2.183	0.62
66_K	104_L	2.103	0.59
136_H	140_C	2.061	0.57
27_I	71_L	1.957	0.53
5_K	8_N	1.924	0.52
63_F	161_Q	1.915	0.51
112_T	135_I	1.858	0.49
57_L	121_A	1.857	0.49
68_I	77_K	1.851	0.49
158_F	166_L	1.849	0.49
69_H	160_D	1.817	0.47
101_L	147_A	1.800	0.47
29_V	135_I	1.728	0.44
127_H	141_L	1.691	0.42
59_V	110_L	1.678	0.42
62_L	108_F	1.675	0.42
87_L	125_H	1.673	0.42
108_F	114_V	1.657	0.41
64_V	142_P	1.645	0.41
1_M	154_P	1.643	0.41
30_F	34_F	1.641	0.40
113_P	117_Y	1.627	0.40
9_L	136_H	1.620	0.40
136_H	139_Y	1.600	0.39
16_V	135_I	1.596	0.39
4_W	72_P	1.586	0.38
68_I	117_Y	1.579	0.38
86_I	134_G	1.574	0.38
34_F	119_A	1.569	0.38
79_K	159_I	1.514	0.36
100_M	150_L	1.492	0.35
55_G	59_V	1.467	0.34
63_F	160_D	1.464	0.34
56_G	110_L	1.458	0.34
59_V	116_F	1.415	0.32
100_M	132_I	1.398	0.32
39_L	151_I	1.388	0.31
51_V	54_F	1.386	0.31
33_T	36_A	1.386	0.31
34_F	139_Y	1.381	0.31
74_I	97_K	1.375	0.31
104_L	132_I	1.372	0.31
77_K	97_K	1.367	0.31
58_L	121_A	1.359	0.30
29_V	137_A	1.351	0.30
3_C	17_R	1.318	0.29
101_L	131_M	1.315	0.29
50_Y	96_P	1.299	0.28
16_V	159_I	1.289	0.28
154_P	168_I	1.285	0.28
112_T	137_A	1.273	0.28
30_F	125_H	1.260	0.27
72_P	154_P	1.238	0.26
2_N	136_H	1.236	0.26
62_L	133_S	1.210	0.26
10_M	61_I	1.208	0.26
12_D	153_A	1.204	0.25
8_N	135_I	1.181	0.25
139_Y	157_A	1.177	0.25
68_I	103_S	1.140	0.24
63_F	127_H	1.134	0.23
23_V	134_G	1.132	0.23
34_F	151_I	1.120	0.23
31_I	167_D	1.105	0.23
70_V	104_L	1.102	0.22
38_E	155_K	1.099	0.22
34_F	37_F	1.096	0.22
54_F	59_V	1.094	0.22
73_I	147_A	1.085	0.22
20_L	135_I	1.084	0.22
141_L	155_K	1.073	0.22
64_V	170_V	1.066	0.21
62_L	100_M	1.054	0.21
95_I	119_A	1.054	0.21
67_V	150_L	1.048	0.21
58_L	157_A	1.047	0.21
48_D	140_C	1.039	0.21
9_L	31_I	1.038	0.21
58_L	164_D	1.024	0.20
62_L	161_Q	1.019	0.20
46_L	131_M	1.017	0.20
97_K	169_L	1.011	0.20
25_F	120_L	1.004	0.20
54_F	64_V	0.994	0.20
31_I	164_D	0.992	0.20
116_F	121_A	0.989	0.20
37_F	126_A	0.988	0.19
97_K	128_Y	0.988	0.19
26_M	77_K	0.982	0.19
75_C	99_T	0.982	0.19
74_I	145_L	0.980	0.19
28_L	111_I	0.973	0.19
89_M	104_L	0.967	0.19
52_S	105_V	0.965	0.19
109_L	120_L	0.960	0.19
128_Y	159_I	0.937	0.18
77_K	126_A	0.936	0.18
65_H	107_P	0.935	0.18
154_P	157_A	0.935	0.18
140_C	163_A	0.934	0.18
57_L	101_L	0.931	0.18
29_V	61_I	0.928	0.18
34_F	125_H	0.922	0.18
102_I	105_V	0.920	0.18
49_E	159_I	0.920	0.18
25_F	75_C	0.912	0.18
38_E	54_F	0.911	0.18
49_E	109_L	0.911	0.18
15_A	109_L	0.908	0.18
77_K	153_A	0.905	0.18
123_P	127_H	0.905	0.18
115_L	136_H	0.897	0.17
97_K	161_Q	0.894	0.17
62_L	114_V	0.892	0.17
1_M	11_K	0.881	0.17
11_K	46_L	0.878	0.17
58_L	109_L	0.875	0.17
61_I	68_I	0.874	0.17
79_K	87_L	0.871	0.17
28_L	159_I	0.870	0.17
26_M	138_G	0.866	0.17
60_V	71_L	0.863	0.17
51_V	146_L	0.856	0.16
23_V	53_L	0.852	0.16
77_K	102_I	0.848	0.16
2_N	31_I	0.845	0.16
17_R	78_R	0.839	0.16
71_L	149_K	0.825	0.16
95_I	144_F	0.821	0.16
37_F	136_H	0.819	0.16
24_C	27_I	0.810	0.15
111_I	132_I	0.810	0.15
100_M	104_L	0.807	0.15
144_F	157_A	0.792	0.15
101_L	159_I	0.790	0.15
55_G	76_K	0.786	0.15
5_K	13_Y	0.778	0.15
33_T	137_A	0.778	0.15
23_V	145_L	0.766	0.15
36_A	114_V	0.766	0.15
84_F	166_L	0.765	0.15
129_F	147_A	0.761	0.14
28_L	37_F	0.758	0.14
146_L	159_I	0.757	0.14
116_F	164_D	0.736	0.14
24_C	140_C	0.734	0.14
128_Y	146_L	0.734	0.14
91_T	133_S	0.733	0.14
104_L	133_S	0.731	0.14
38_E	110_L	0.725	0.14
112_T	150_L	0.724	0.14
138_G	142_P	0.723	0.14
4_W	30_F	0.722	0.14
71_L	118_A	0.721	0.14
4_W	13_Y	0.717	0.14
4_W	154_P	0.715	0.14
6_T	154_P	0.711	0.14
7_I	31_I	0.707	0.13
11_K	72_P	0.706	0.13
63_F	91_T	0.702	0.13
4_W	8_N	0.696	0.13
66_K	91_T	0.696	0.13
68_I	109_L	0.696	0.13
69_H	143_D	0.690	0.13
87_L	113_P	0.689	0.13
31_I	44_T	0.689	0.13
53_L	120_L	0.682	0.13
135_I	167_D	0.679	0.13
108_F	136_H	0.678	0.13
81_E	119_A	0.678	0.13
70_V	112_T	0.673	0.13
59_V	64_V	0.671	0.13
14_G	128_Y	0.668	0.13
4_W	153_A	0.667	0.13
63_F	134_G	0.666	0.13
105_V	117_Y	0.665	0.13
55_G	158_F	0.664	0.13
79_K	89_M	0.659	0.13
127_H	135_I	0.658	0.13
57_L	73_I	0.654	0.12
18_I	90_R	0.653	0.12
56_G	122_F	0.650	0.12
46_L	61_I	0.650	0.12
6_T	170_V	0.648	0.12
122_F	145_L	0.647	0.12
13_Y	32_S	0.645	0.12
18_I	85_Y	0.644	0.12
94_R	165_G	0.643	0.12
63_F	148_L	0.642	0.12
72_P	122_F	0.641	0.12
11_K	154_P	0.640	0.12
150_L	166_L	0.639	0.12
27_I	96_P	0.635	0.12
54_F	81_E	0.630	0.12
23_V	88_R	0.628	0.12
9_L	159_I	0.628	0.12
63_F	133_S	0.627	0.12
48_D	127_H	0.626	0.12
1_M	4_W	0.625	0.12
20_L	147_A	0.620	0.12
22_A	94_R	0.619	0.12
25_F	112_T	0.619	0.12
53_L	150_L	0.618	0.12
73_I	115_L	0.616	0.12
97_K	143_D	0.615	0.12
40_L	82_K	0.615	0.12
95_I	104_L	0.612	0.12
145_L	169_L	0.610	0.12
55_G	146_L	0.609	0.12
30_F	168_I	0.604	0.12
112_T	162_E	0.604	0.12
59_V	78_R	0.601	0.12
78_R	119_A	0.599	0.12
80_I	86_I	0.593	0.11
29_V	170_V	0.593	0.11
100_M	140_C	0.592	0.11
30_F	112_T	0.583	0.11
28_L	103_S	0.582	0.11
135_I	162_E	0.574	0.11
59_V	141_L	0.572	0.11
13_Y	77_K	0.570	0.11
4_W	157_A	0.570	0.11
34_F	153_A	0.561	0.11
8_N	150_L	0.556	0.11
91_T	115_L	0.555	0.11
9_L	86_I	0.554	0.11
45_S	80_I	0.550	0.11
96_P	154_P	0.547	0.11
136_H	170_V	0.546	0.11
29_V	112_T	0.543	0.11
14_G	34_F	0.542	0.11
153_A	168_I	0.540	0.11
140_C	170_V	0.534	0.11
2_N	29_V	0.520	0.10
41_R	109_L	0.519	0.10
97_K	145_L	0.519	0.10
17_R	169_L	0.517	0.10
131_M	147_A	0.515	0.10
16_V	20_L	0.515	0.10
40_L	122_F	0.511	0.10
28_L	101_L	0.510	0.10
66_K	90_R	0.509	0.10
23_V	141_L	0.508	0.10
55_G	86_I	0.504	0.10
80_I	166_L	0.502	0.10
24_C	40_L	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ar4A	1	0.4535	4.7	0.965	Contact Map
1qp6A	2	0.1977	4.5	0.965	Contact Map
4ldeA	1	0.5	4.2	0.966	Contact Map
2lxwA	1	0.1221	3.8	0.966	Contact Map
4ev6A	3	0.4302	3.6	0.967	Contact Map
4yayA	1	0.4535	3.5	0.967	Contact Map
3ixzA	1	0.5	3.2	0.968	Contact Map
4n6hA	1	0.5407	3.1	0.968	Contact Map
4i0uA	4	0.4186	3	0.968	Contact Map
3tkkA	2	0.3372	2.7	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.