HIT - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIT - Protein hit

UniProt:	O07513	Sequences: MHCAENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDELAKQYFHAVPKIARAIRDEFEPIGLNTLNNNGEKAGQSVFHYHMHIIPRYGKGDGFGAVWKTHADDYKPEDLQNISSSIAKRLASS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (132)
Sequences:	4283 (2854)
Seq/√Len:	248.4

ECOLI - HINT
BACSU - HIT
HALSA - Q9HNA0 Q9HP05
SULSO - Q980P0 YHIT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_C	10_C	3.399	1.00
27_H	63_Q	3.066	1.00
24_E	47_K	3.040	1.00
48_T	60_L	2.998	1.00
10_C	49_H	2.725	1.00
28_V	67_A	2.725	1.00
7_C	49_H	2.704	1.00
58_D	69_P	2.660	1.00
57_T	60_L	2.418	1.00
25_D	63_Q	2.402	1.00
68_V	103_M	2.366	1.00
31_F	45_I	2.106	1.00
56_F	101_Y	2.002	1.00
28_V	63_Q	1.995	1.00
11_K	16_D	1.952	1.00
58_D	66_H	1.906	1.00
20_A	132_Q	1.905	1.00
15_G	21_K	1.892	1.00
62_K	66_H	1.888	1.00
19_S	29_L	1.741	1.00
133_N	137_S	1.707	1.00
48_T	57_T	1.697	1.00
10_C	14_A	1.689	1.00
64_Y	103_M	1.677	1.00
21_K	29_L	1.674	1.00
23_Y	67_A	1.625	1.00
126_Y	131_L	1.577	1.00
42_T	71_I	1.568	1.00
22_V	42_T	1.496	1.00
85_N	108_R	1.478	1.00
50_I	57_T	1.477	1.00
29_L	47_K	1.425	1.00
39_K	130_D	1.424	1.00
132_Q	136_S	1.419	1.00
61_A	65_F	1.411	1.00
82_I	93_K	1.394	1.00
52_N	55_E	1.390	1.00
135_S	139_A	1.379	1.00
74_A	78_E	1.358	1.00
69_P	73_R	1.332	1.00
65_F	103_M	1.309	1.00
76_R	84_L	1.267	1.00
21_K	24_E	1.241	1.00
44_V	68_V	1.235	1.00
54_Y	76_R	1.215	1.00
12_I	19_S	1.191	1.00
88_N	103_M	1.164	1.00
50_I	56_F	1.160	1.00
61_A	69_P	1.149	1.00
29_L	45_I	1.126	1.00
38_T	109_Y	1.112	1.00
50_I	60_L	1.111	1.00
32_L	42_T	1.109	1.00
44_V	105_I	1.097	1.00
128_P	132_Q	1.088	1.00
127_K	130_D	1.085	1.00
126_Y	134_I	1.084	1.00
64_Y	101_Y	1.079	1.00
52_N	76_R	1.065	1.00
93_K	110_G	1.065	1.00
30_A	42_T	1.048	1.00
51_E	55_E	1.048	1.00
118_V	121_T	1.032	1.00
75_I	138_I	1.028	1.00
75_I	105_I	1.027	1.00
20_A	128_P	1.025	1.00
30_A	71_I	1.024	1.00
20_A	131_L	1.021	1.00
9_F	98_V	1.018	1.00
51_E	91_G	1.016	1.00
53_V	65_F	0.993	1.00
20_A	32_L	0.981	1.00
39_K	137_S	0.971	1.00
131_L	135_S	0.946	1.00
81_P	109_Y	0.941	1.00
68_V	86_T	0.926	1.00
85_N	89_N	0.925	1.00
27_H	60_L	0.923	1.00
133_N	136_S	0.922	1.00
11_K	17_I	0.921	1.00
129_E	132_Q	0.912	1.00
65_F	68_V	0.911	1.00
130_D	133_N	0.888	1.00
63_Q	67_A	0.881	1.00
79_F	134_I	0.878	1.00
25_D	70_K	0.856	0.99
42_T	75_I	0.854	0.99
40_G	107_P	0.849	0.99
25_D	67_A	0.840	0.99
72_A	84_L	0.838	0.99
51_E	99_F	0.827	0.99
116_G	119_W	0.825	0.99
56_F	60_L	0.820	0.99
38_T	106_I	0.813	0.99
8_I	98_V	0.812	0.99
52_N	91_G	0.803	0.99
6_N	11_K	0.803	0.99
88_N	101_Y	0.799	0.99
136_S	139_A	0.797	0.99
58_D	62_K	0.792	0.99
83_G	93_K	0.791	0.99
72_A	76_R	0.788	0.99
13_I	45_I	0.778	0.99
56_F	61_A	0.776	0.99
50_I	55_E	0.774	0.99
86_T	103_M	0.773	0.99
128_P	131_L	0.772	0.99
30_A	67_A	0.772	0.99
78_E	137_S	0.768	0.99
82_I	109_Y	0.760	0.99
82_I	110_G	0.755	0.99
13_I	29_L	0.748	0.98
50_I	101_Y	0.746	0.98
66_H	69_P	0.746	0.98
52_N	99_F	0.741	0.98
39_K	134_I	0.740	0.98
96_Q	99_F	0.720	0.98
85_N	94_A	0.715	0.98
8_I	11_K	0.711	0.98
76_R	91_G	0.708	0.98
84_L	105_I	0.692	0.97
13_I	47_K	0.691	0.97
126_Y	130_D	0.688	0.97
129_E	133_N	0.686	0.97
12_I	34_I	0.682	0.97
74_A	138_I	0.679	0.97
135_S	138_I	0.669	0.97
75_I	81_P	0.667	0.97
54_Y	73_R	0.661	0.97
66_H	70_K	0.659	0.97
60_L	63_Q	0.658	0.97
91_G	94_A	0.655	0.96
125_D	128_P	0.651	0.96
20_A	135_S	0.643	0.96
115_F	118_V	0.634	0.96
15_G	19_S	0.632	0.96
28_V	64_Y	0.626	0.95
122_H	125_D	0.624	0.95
54_Y	84_L	0.622	0.95
126_Y	129_E	0.622	0.95
92_E	99_F	0.619	0.95
134_I	137_S	0.617	0.95
76_R	81_P	0.615	0.95
8_I	17_I	0.612	0.95
53_V	86_T	0.608	0.95
25_D	28_V	0.608	0.95
116_G	120_K	0.608	0.95
132_Q	139_A	0.607	0.95
114_G	117_A	0.606	0.95
22_V	139_A	0.605	0.95
131_L	134_I	0.603	0.94
118_V	122_H	0.601	0.94
52_N	90_N	0.601	0.94
108_R	112_G	0.596	0.94
20_A	34_I	0.595	0.94
130_D	134_I	0.594	0.94
12_I	31_F	0.594	0.94
81_P	84_L	0.594	0.94
79_F	109_Y	0.593	0.94
12_I	45_I	0.592	0.94
37_V	87_L	0.584	0.93
39_K	133_N	0.568	0.92
9_F	45_I	0.567	0.92
33_D	106_I	0.562	0.92
78_E	138_I	0.559	0.92
37_V	97_S	0.558	0.92
83_G	108_R	0.556	0.92
109_Y	112_G	0.555	0.92
63_Q	66_H	0.555	0.92
6_N	14_A	0.553	0.91
54_Y	72_A	0.543	0.91
78_E	81_P	0.540	0.90
108_R	111_K	0.534	0.90
72_A	86_T	0.534	0.90
32_L	131_L	0.533	0.90
44_V	67_A	0.533	0.90
85_N	106_I	0.532	0.90
12_I	15_G	0.530	0.90
30_A	44_V	0.529	0.90
68_V	75_I	0.528	0.89
117_A	121_T	0.525	0.89
23_Y	30_A	0.524	0.89
127_K	132_Q	0.522	0.89
83_G	96_Q	0.517	0.89
41_H	104_H	0.517	0.89
129_E	137_S	0.514	0.88
117_A	120_K	0.513	0.88
71_I	74_A	0.513	0.88
53_V	88_N	0.512	0.88
35_S	125_D	0.510	0.88
119_W	122_H	0.508	0.88
70_K	74_A	0.507	0.88
96_Q	108_R	0.503	0.87
56_F	64_Y	0.502	0.87
61_A	66_H	0.501	0.87
87_L	106_I	0.500	0.87
62_K	65_F	0.500	0.87
21_K	47_K	0.500	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ksvA	2	0.9586	100	0.208	Contact Map
1y23A	2	0.9724	100	0.225	Contact Map
3l7xA	2	0.9586	100	0.232	Contact Map
3imiA	2	0.9793	100	0.233	Contact Map
3lb5A	2	0.9448	100	0.24	Contact Map
2eo4A	2	0.9448	100	0.259	Contact Map
3anoA	4	0.9862	100	0.261	Contact Map
3o0mA	2	0.9241	100	0.274	Contact Map
1emsA	3	0.8828	100	0.282	Contact Map
3r6fA	2	0.8966	100	0.295	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.