YVEG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVEG - UPF0311 protein YveG

UniProt:	O07005	Sequences: MVLVKKPVLKPFASLEIKVDPPITIGETSLGLRXFIPIPIRSGTITGEVKGRILPGGADSQMIRANGRTDLSARYVIETADHELIYIENNGIRQVSKPFRKQAAAGEIIEPEHVYFRTVPTFETGSEVYQWLHDRLFIGSAERTPDYVLLDIYEVQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (148)
Sequences:	614 (497)
Seq/√Len:	40.8

BACSU - YVEG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_R	78_E	6.489	1.00
14_S	151_D	3.745	1.00
79_T	129_Y	3.656	1.00
10_K	154_E	3.651	1.00
81_D	129_Y	3.622	1.00
124_T	127_E	3.048	1.00
12_F	137_F	2.576	1.00
122_F	132_L	2.552	1.00
46_T	50_K	2.411	1.00
11_P	14_S	2.399	1.00
24_T	32_L	2.300	1.00
85_I	122_F	2.279	1.00
120_P	152_I	2.215	1.00
83_E	126_S	2.129	0.99
45_I	51_G	2.092	0.99
73_A	89_N	2.019	0.99
119_V	136_L	2.012	0.99
135_R	154_E	2.004	0.99
83_E	124_T	1.968	0.99
90_N	121_T	1.957	0.99
79_T	83_E	1.859	0.98
75_Y	89_N	1.818	0.98
51_G	77_I	1.786	0.98
33_R	123_E	1.785	0.98
35_F	58_A	1.765	0.98
102_Q	107_E	1.722	0.97
45_I	77_I	1.716	0.97
93_R	143_R	1.636	0.96
95_V	100_R	1.625	0.96
11_P	48_E	1.610	0.96
89_N	118_T	1.555	0.95
12_F	135_R	1.516	0.94
102_Q	113_H	1.445	0.93
130_Q	134_D	1.434	0.92
74_R	88_E	1.408	0.92
64_R	70_D	1.400	0.91
89_N	120_P	1.387	0.91
83_E	129_Y	1.384	0.91
23_I	84_L	1.380	0.91
83_E	128_V	1.320	0.89
20_D	41_R	1.302	0.88
89_N	150_L	1.296	0.88
91_G	118_T	1.267	0.87
83_E	125_G	1.255	0.86
89_N	141_A	1.246	0.86
72_S	88_E	1.234	0.85
12_F	49_V	1.216	0.84
29_S	133_H	1.187	0.83
34_X	93_R	1.161	0.81
124_T	128_V	1.153	0.81
76_V	84_L	1.124	0.79
9_L	155_V	1.120	0.79
83_E	127_E	1.118	0.79
43_G	51_G	1.113	0.78
14_S	149_L	1.110	0.78
12_F	132_L	1.109	0.78
102_Q	106_G	1.109	0.78
116_F	141_A	1.108	0.78
86_Y	123_E	1.107	0.78
45_I	49_V	1.084	0.77
75_Y	87_I	1.065	0.75
17_I	40_I	1.062	0.75
122_F	137_F	1.060	0.75
77_I	122_F	1.027	0.73
33_R	62_M	1.000	0.71
10_K	48_E	0.995	0.70
9_L	153_Y	0.994	0.70
43_G	57_G	0.988	0.70
36_I	61_Q	0.982	0.69
50_K	80_A	0.974	0.68
73_A	118_T	0.959	0.67
12_F	154_E	0.934	0.65
130_Q	133_H	0.932	0.65
93_R	116_F	0.930	0.65
40_I	53_I	0.926	0.65
72_S	150_L	0.923	0.64
18_K	41_R	0.920	0.64
40_I	57_G	0.914	0.64
18_K	42_S	0.908	0.63
102_Q	105_A	0.907	0.63
34_X	61_Q	0.904	0.63
118_T	139_G	0.902	0.62
24_T	34_X	0.899	0.62
142_E	149_L	0.893	0.62
89_N	137_F	0.887	0.61
73_A	150_L	0.883	0.61
60_S	118_T	0.880	0.61
100_R	103_A	0.879	0.60
19_V	73_A	0.876	0.60
25_I	76_V	0.875	0.60
49_V	85_I	0.862	0.59
79_T	85_I	0.850	0.58
101_K	104_A	0.845	0.57
25_I	35_F	0.844	0.57
40_I	75_Y	0.842	0.57
6_K	27_E	0.840	0.57
101_K	105_A	0.838	0.57
99_F	114_V	0.837	0.57
20_D	37_P	0.829	0.56
79_T	133_H	0.823	0.55
67_G	104_A	0.819	0.55
73_A	87_I	0.819	0.55
71_L	91_G	0.814	0.55
60_S	91_G	0.808	0.54
54_L	78_E	0.806	0.54
40_I	89_N	0.805	0.54
18_K	44_T	0.799	0.53
95_V	103_A	0.786	0.52
76_V	141_A	0.783	0.52
61_Q	143_R	0.778	0.51
60_S	74_R	0.768	0.50
94_Q	134_D	0.752	0.49
55_P	64_R	0.748	0.48
109_I	114_V	0.744	0.48
124_T	133_H	0.740	0.48
30_L	123_E	0.740	0.48
42_S	148_V	0.734	0.47
95_V	109_I	0.733	0.47
58_A	87_I	0.726	0.46
80_A	85_I	0.718	0.46
28_T	125_G	0.716	0.46
10_K	135_R	0.713	0.45
37_P	58_A	0.712	0.45
75_Y	148_V	0.711	0.45
72_S	124_T	0.706	0.45
48_E	153_Y	0.705	0.45
95_V	114_V	0.704	0.44
49_V	132_L	0.704	0.44
89_N	152_I	0.692	0.43
67_G	113_H	0.685	0.43
78_E	84_L	0.663	0.41
95_V	143_R	0.663	0.41
41_R	147_Y	0.661	0.41
138_I	155_V	0.658	0.40
109_I	113_H	0.657	0.40
105_A	108_I	0.657	0.40
139_G	150_L	0.655	0.40
60_S	76_V	0.654	0.40
17_I	45_I	0.651	0.40
40_I	87_I	0.650	0.40
85_I	131_W	0.647	0.39
97_K	101_K	0.644	0.39
102_Q	109_I	0.639	0.39
22_P	106_G	0.639	0.39
8_V	65_A	0.638	0.38
47_G	131_W	0.637	0.38
44_T	80_A	0.635	0.38
53_I	60_S	0.634	0.38
71_L	153_Y	0.631	0.38
27_E	32_L	0.630	0.38
104_A	144_T	0.626	0.37
19_V	116_F	0.626	0.37
28_T	40_I	0.625	0.37
60_S	72_S	0.624	0.37
84_L	125_G	0.619	0.37
43_G	53_I	0.618	0.37
136_L	155_V	0.614	0.36
68_R	94_Q	0.612	0.36
76_V	86_Y	0.607	0.36
82_H	132_L	0.605	0.36
19_V	67_G	0.602	0.35
49_V	80_A	0.599	0.35
61_Q	139_G	0.598	0.35
16_E	147_Y	0.594	0.35
14_S	117_R	0.592	0.35
20_D	105_A	0.590	0.34
61_Q	69_T	0.589	0.34
37_P	42_S	0.585	0.34
93_R	109_I	0.583	0.34
13_A	19_V	0.582	0.34
24_T	36_I	0.581	0.34
36_I	148_V	0.579	0.33
61_Q	148_V	0.579	0.33
12_F	129_Y	0.576	0.33
44_T	110_E	0.572	0.33
24_T	72_S	0.569	0.33
56_G	116_F	0.564	0.32
139_G	148_V	0.563	0.32
35_F	76_V	0.560	0.32
104_A	134_D	0.559	0.32
36_I	75_Y	0.558	0.32
45_I	137_F	0.555	0.32
96_S	114_V	0.553	0.31
17_I	75_Y	0.552	0.31
120_P	137_F	0.552	0.31
95_V	99_F	0.551	0.31
65_A	132_L	0.551	0.31
114_V	143_R	0.550	0.31
37_P	40_I	0.541	0.30
58_A	74_R	0.537	0.30
49_V	54_L	0.537	0.30
16_E	20_D	0.534	0.30
45_I	50_K	0.534	0.30
18_K	147_Y	0.533	0.30
103_A	114_V	0.530	0.30
93_R	96_S	0.529	0.29
61_Q	93_R	0.529	0.29
99_F	103_A	0.523	0.29
15_L	69_T	0.522	0.29
123_E	127_E	0.522	0.29
127_E	130_Q	0.519	0.29
61_Q	73_A	0.519	0.29
20_D	55_P	0.518	0.29
40_I	148_V	0.517	0.29
13_A	77_I	0.517	0.29
53_I	146_D	0.513	0.28
97_K	155_V	0.512	0.28
104_A	109_I	0.512	0.28
111_P	143_R	0.511	0.28
16_E	44_T	0.510	0.28
48_E	110_E	0.510	0.28
99_F	113_H	0.508	0.28
27_E	30_L	0.508	0.28
58_A	86_Y	0.508	0.28
35_F	60_S	0.507	0.28
20_D	108_I	0.507	0.28
27_E	46_T	0.506	0.28
17_I	89_N	0.506	0.28
71_L	116_F	0.506	0.28
72_S	117_R	0.505	0.28
48_E	107_E	0.501	0.27
131_W	139_G	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3g7gA	3	0.9551	100	0.126	Contact Map
4puxA	4	0.9872	100	0.127	Contact Map
3c5oA	4	0.9679	100	0.141	Contact Map
3etoA	1	0.6282	4.8	0.956	Contact Map
2c5qA	3	0.6859	4	0.957	Contact Map
4tq2A	2	0.6923	3.7	0.958	Contact Map
2oo4A	1	0.5962	3.7	0.958	Contact Map
1dp7P	1	0.1859	2.9	0.96	Contact Map
1q5xA	3	0.3846	2.6	0.961	Contact Map
3oaeA	5	0.3205	2.5	0.961	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.