PGMB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PGMB - Beta-phosphoglucomutase

UniProt:	O06995	Sequences: MKAVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDRDMNERLKGISREESLESILIFGGAETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAPKILRRLAIIDDFHAIVDPTTLAKGKPDPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKSAGMFAVGVGQGQPMLGADLVVRQTSDLTLELLHEEWEQYRIRESIP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	226 (195)
Sequences:	27694 (21807)
Seq/√Len:	1561.6

ECOLI - PGMB GPH YNIC YFBT YIGB YIEH YRFG YJJG YQAB YIHX
BACSU - PGMB YHCW YSAA PPAX YFNB
HALSA - Q9HSS2 Q9HQE2 Q9HP74 Q9HMC4
SULSO - Q7LXL6 Q97ZU6 Q7LX46 Q97WT6 Q97X58 Q97YZ1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_K	164_D	4.112	1.00
124_R	129_I	3.071	1.00
153_T	157_M	2.934	1.00
143_K	147_D	2.843	1.00
178_I	185_A	2.668	1.00
169_E	174_G	2.598	1.00
101_C	131_D	2.453	1.00
3_A	160_V	2.416	1.00
97_G	101_C	2.359	1.00
109_K	133_H	2.301	1.00
153_T	156_A	2.263	1.00
29_Q	75_R	2.226	1.00
111_G	134_A	2.221	1.00
113_A	150_I	2.156	1.00
6_F	110_I	2.113	1.00
155_A	165_C	2.106	1.00
143_K	149_D	2.073	1.00
179_K	198_D	2.056	1.00
202_R	206_D	2.049	1.00
134_A	157_M	2.025	1.00
175_I	185_A	1.989	1.00
25_H	79_D	1.981	1.00
176_S	180_S	1.903	1.00
184_F	198_D	1.872	1.00
161_S	164_D	1.859	1.00
102_Q	106_E	1.843	1.00
114_S	119_A	1.797	1.00
167_A	178_I	1.732	1.00
104_K	133_H	1.717	1.00
155_A	183_M	1.716	1.00
4_V	108_I	1.705	1.00
102_Q	208_T	1.686	1.00
104_K	131_D	1.678	1.00
96_I	204_T	1.669	1.00
166_A	186_V	1.655	1.00
5_I	167_A	1.619	1.00
160_V	165_C	1.581	1.00
120_P	129_I	1.577	1.00
110_I	132_F	1.571	1.00
3_A	158_L	1.541	1.00
5_I	154_A	1.538	1.00
155_A	162_P	1.508	1.00
189_G	202_R	1.494	1.00
29_Q	79_D	1.493	1.00
5_I	113_A	1.491	1.00
30_I	75_R	1.465	1.00
4_V	103_L	1.435	1.00
4_V	168_I	1.434	1.00
49_E	52_E	1.429	1.00
111_G	158_L	1.410	1.00
93_L	190_Q	1.386	1.00
35_D	38_M	1.358	1.00
186_V	201_V	1.342	1.00
79_D	82_M	1.322	1.00
189_G	200_V	1.321	1.00
25_H	83_L	1.299	1.00
11_V	168_I	1.290	1.00
8_L	13_T	1.275	1.00
12_I	96_I	1.264	1.00
68_E	71_E	1.259	1.00
172_E	176_S	1.252	1.00
102_Q	105_N	1.250	1.00
99_L	204_T	1.246	1.00
25_H	29_Q	1.241	1.00
203_Q	206_D	1.241	1.00
75_R	78_R	1.237	1.00
186_V	199_L	1.224	1.00
136_V	157_M	1.215	1.00
83_L	86_K	1.203	1.00
151_F	177_A	1.197	1.00
8_L	112_L	1.197	1.00
120_P	124_R	1.194	1.00
95_G	98_R	1.192	1.00
99_L	208_T	1.175	1.00
92_L	128_I	1.161	1.00
8_L	119_A	1.153	1.00
151_F	167_A	1.145	1.00
5_I	165_C	1.144	1.00
148_P	152_L	1.142	1.00
136_V	154_A	1.134	1.00
98_R	205_S	1.128	1.00
9_D	15_T	1.116	1.00
74_H	78_R	1.093	1.00
75_R	79_D	1.093	1.00
21_L	83_L	1.086	1.00
79_D	83_L	1.082	1.00
119_A	137_D	1.074	1.00
165_C	183_M	1.068	1.00
151_F	183_M	1.068	1.00
26_I	30_I	1.061	1.00
71_E	75_R	1.056	1.00
149_D	153_T	1.055	1.00
28_E	33_P	1.046	1.00
113_A	154_A	1.042	1.00
112_L	132_F	1.037	1.00
8_L	116_S	1.036	1.00
101_C	105_N	1.027	1.00
166_A	184_F	1.016	1.00
78_R	82_M	1.010	1.00
179_K	185_A	1.009	1.00
152_L	156_A	1.002	1.00
24_K	28_E	1.000	1.00
134_A	158_L	0.990	1.00
104_K	110_I	0.989	1.00
21_L	25_H	0.981	1.00
184_F	199_L	0.981	1.00
191_G	194_M	0.980	1.00
127_A	130_D	0.975	1.00
52_E	69_K	0.973	1.00
25_H	28_E	0.973	1.00
97_G	131_D	0.971	1.00
137_D	140_T	0.967	1.00
151_F	169_E	0.964	1.00
152_L	181_A	0.960	1.00
121_K	125_R	0.957	1.00
85_S	121_K	0.953	1.00
100_L	132_F	0.949	1.00
3_A	109_K	0.947	1.00
52_E	56_I	0.944	1.00
121_K	124_R	0.942	1.00
36_R	40_E	0.938	1.00
48_E	52_E	0.935	1.00
167_A	183_M	0.931	1.00
98_R	101_C	0.915	1.00
154_A	158_L	0.910	1.00
9_D	116_S	0.909	1.00
101_C	130_D	0.904	1.00
45_I	49_E	0.903	1.00
95_G	203_Q	0.898	1.00
179_K	196_G	0.897	1.00
173_A	176_S	0.885	1.00
93_L	188_V	0.882	1.00
187_G	200_V	0.879	1.00
142_A	149_D	0.871	1.00
21_L	24_K	0.869	1.00
5_I	158_L	0.862	1.00
136_V	153_T	0.843	1.00
45_I	53_S	0.842	1.00
149_D	152_L	0.837	1.00
119_A	122_I	0.835	1.00
103_L	108_I	0.834	1.00
168_I	186_V	0.833	1.00
92_L	97_G	0.831	1.00
152_L	162_P	0.820	1.00
141_L	153_T	0.818	1.00
53_S	56_I	0.815	1.00
201_V	207_L	0.814	1.00
162_P	183_M	0.809	1.00
48_E	70_Q	0.805	1.00
37_D	41_R	0.804	1.00
9_D	170_D	0.799	1.00
103_L	110_I	0.795	1.00
49_E	53_S	0.791	1.00
177_A	181_A	0.789	1.00
51_L	55_L	0.788	1.00
3_A	165_C	0.786	1.00
4_V	166_A	0.785	1.00
114_S	137_D	0.783	1.00
27_A	32_I	0.783	1.00
5_I	183_M	0.777	1.00
3_A	111_G	0.771	1.00
20_F	24_K	0.768	1.00
38_M	41_R	0.767	1.00
93_L	96_I	0.763	1.00
9_D	114_S	0.760	1.00
111_G	154_A	0.759	1.00
24_K	36_R	0.749	1.00
95_G	205_S	0.746	1.00
70_Q	74_H	0.745	1.00
117_R	121_K	0.737	1.00
100_L	131_D	0.737	1.00
8_L	122_I	0.733	1.00
175_I	197_A	0.732	1.00
19_H	76_K	0.732	1.00
185_A	198_D	0.727	1.00
46_S	49_E	0.727	1.00
97_G	130_D	0.724	1.00
56_I	59_G	0.722	1.00
175_I	187_G	0.721	1.00
168_I	207_L	0.721	1.00
13_T	122_I	0.716	1.00
188_V	204_T	0.716	1.00
110_I	131_D	0.714	1.00
120_P	135_I	0.713	1.00
47_R	50_S	0.706	1.00
134_A	154_A	0.706	1.00
160_V	164_D	0.699	1.00
5_I	111_G	0.695	1.00
150_I	154_A	0.694	1.00
20_F	39_N	0.693	1.00
151_F	174_G	0.690	1.00
22_A	26_I	0.687	1.00
176_S	179_K	0.686	1.00
10_G	16_A	0.684	1.00
190_Q	204_T	0.678	1.00
73_M	77_N	0.677	1.00
18_Y	90_E	0.674	1.00
11_V	188_V	0.666	1.00
115_S	144_G	0.663	1.00
14_D	91_D	0.663	1.00
13_T	126_L	0.661	1.00
150_I	177_A	0.660	1.00
17_E	91_D	0.659	1.00
119_A	135_I	0.658	1.00
141_L	150_I	0.657	1.00
47_R	51_L	0.655	1.00
97_G	127_A	0.650	1.00
92_L	126_L	0.649	1.00
13_T	90_E	0.646	1.00
113_A	167_A	0.645	1.00
74_H	77_N	0.637	1.00
39_N	43_K	0.636	1.00
201_V	204_T	0.636	1.00
72_L	75_R	0.635	1.00
76_K	80_Y	0.629	1.00
98_R	102_Q	0.626	1.00
123_L	129_I	0.626	1.00
167_A	174_G	0.620	1.00
136_V	150_I	0.619	1.00
148_P	180_S	0.618	1.00
22_A	79_D	0.618	1.00
80_Y	84_I	0.618	1.00
110_I	133_H	0.617	1.00
30_I	72_L	0.616	1.00
99_L	168_I	0.615	1.00
9_D	122_I	0.615	1.00
46_S	50_S	0.615	1.00
2_K	160_V	0.614	1.00
109_K	160_V	0.614	1.00
116_S	119_A	0.613	1.00
187_G	197_A	0.611	1.00
95_G	99_L	0.611	1.00
40_E	43_K	0.609	1.00
19_H	23_W	0.607	1.00
53_S	57_F	0.607	1.00
55_L	58_G	0.601	1.00
85_S	125_R	0.601	1.00
167_A	177_A	0.597	1.00
186_V	207_L	0.594	1.00
82_M	85_S	0.593	1.00
205_S	208_T	0.591	1.00
204_T	208_T	0.587	1.00
11_V	174_G	0.585	1.00
48_E	69_K	0.583	1.00
113_A	136_V	0.580	1.00
162_P	165_C	0.578	1.00
14_D	17_E	0.578	1.00
45_I	50_S	0.577	1.00
81_Q	117_R	0.576	1.00
116_S	169_E	0.575	1.00
19_H	116_S	0.575	1.00
30_I	71_E	0.575	1.00
82_M	86_K	0.573	1.00
81_Q	121_K	0.568	1.00
151_F	178_I	0.567	1.00
132_F	135_I	0.566	1.00
101_C	104_K	0.564	1.00
2_K	108_I	0.563	1.00
6_F	99_L	0.559	1.00
140_T	157_M	0.559	1.00
48_E	73_M	0.558	1.00
37_D	40_E	0.556	1.00
94_P	205_S	0.552	1.00
36_R	39_N	0.552	1.00
155_A	160_V	0.552	1.00
134_A	137_D	0.548	1.00
118_N	122_I	0.548	1.00
19_H	80_Y	0.547	1.00
41_R	53_S	0.547	1.00
96_I	99_L	0.546	1.00
138_P	150_I	0.540	1.00
95_G	190_Q	0.539	1.00
38_M	43_K	0.535	1.00
124_R	130_D	0.530	1.00
96_I	100_L	0.529	1.00
155_A	181_A	0.527	1.00
152_L	155_A	0.526	1.00
41_R	57_F	0.526	1.00
173_A	177_A	0.526	1.00
39_N	42_L	0.525	1.00
71_E	74_H	0.524	1.00
17_E	21_L	0.524	1.00
104_K	130_D	0.521	1.00
20_F	36_R	0.519	1.00
38_M	42_L	0.519	1.00
115_S	173_A	0.517	1.00
26_I	75_R	0.509	1.00
50_S	55_L	0.507	1.00
15_T	116_S	0.507	1.00
99_L	103_L	0.505	1.00
115_S	146_P	0.504	1.00
14_D	93_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4uw9A	1	0.9292	100	0.26	Contact Map
3nasA	2	0.9513	100	0.27	Contact Map
2wf7A	1	0.9558	100	0.296	Contact Map
1swvA	2	0.9381	100	0.313	Contact Map
4g9bA	2	0.9646	100	0.317	Contact Map
3iruA	4	0.9735	100	0.318	Contact Map
3s6jA	2	0.9336	100	0.321	Contact Map
4gibA	1	0.9779	100	0.324	Contact Map
3l5kA	1	0.9292	100	0.327	Contact Map
1te2A	2	0.9159	100	0.329	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.