YVDD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVDD - LOG family protein YvdD

UniProt:	O06986	Sequences: MKTICVFAGSNPGGNEAYKRKAAELGVYMAEQGIGLVYGGSRVGLMGTIADAIMENGGTAIGVMPSGLFSGEVVHQNLTELIEVNGMHERKAKMSELADGFISMPGGFGTYEELFEVLCWAQIGIHQKPIGLYNVNGYFEPMMKMVKYSIQEGFSNESHLKLIHSSSRPDELIEQMQNYSYPILEKKWTEI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	191 (176)
Sequences:	4280 (2750)
Seq/√Len:	207.3

BACSU - YVDD
SULSO - Q97YR0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
147_K	160_L	3.030	1.00
3_T	35_G	2.890	1.00
27_V	31_E	2.399	1.00
134_N	140_E	2.354	1.00
143_M	165_S	2.310	1.00
19_K	48_T	2.278	1.00
67_G	125_I	2.221	1.00
5_C	98_A	2.175	1.00
66_S	70_S	2.167	1.00
82_I	93_K	2.166	1.00
28_Y	170_D	2.114	1.00
88_H	120_W	2.094	1.00
32_Q	177_Q	2.060	1.00
100_G	176_M	2.040	1.00
166_S	175_Q	1.941	1.00
168_R	171_E	1.937	1.00
174_E	178_N	1.916	1.00
93_K	97_L	1.885	1.00
21_K	24_E	1.877	1.00
85_N	89_E	1.849	1.00
35_G	59_T	1.842	1.00
51_D	75_H	1.820	1.00
108_F	118_L	1.818	1.00
137_G	140_E	1.795	1.00
141_P	145_M	1.793	1.00
166_S	171_E	1.772	1.00
164_H	175_Q	1.760	1.00
103_S	114_L	1.739	1.00
66_S	85_N	1.706	1.00
30_A	58_G	1.679	1.00
54_M	79_T	1.669	1.00
25_L	102_I	1.659	1.00
17_A	136_N	1.628	1.00
28_Y	32_Q	1.605	1.00
114_L	132_L	1.595	1.00
86_G	89_E	1.577	1.00
28_Y	31_E	1.574	1.00
131_G	172_L	1.561	1.00
15_N	136_N	1.555	1.00
111_Y	149_S	1.521	1.00
48_T	52_A	1.482	1.00
148_Y	152_E	1.452	1.00
11_N	156_N	1.437	1.00
31_E	56_N	1.425	1.00
29_M	34_I	1.415	1.00
35_G	61_I	1.407	1.00
27_V	56_N	1.406	1.00
23_A	52_A	1.405	1.00
28_Y	169_P	1.384	1.00
20_R	23_A	1.366	1.00
23_A	51_D	1.363	1.00
23_A	48_T	1.363	1.00
141_P	144_K	1.357	1.00
149_S	155_S	1.340	1.00
30_A	56_N	1.337	1.00
115_F	146_V	1.334	1.00
18_Y	152_E	1.332	1.00
92_A	96_E	1.329	1.00
59_T	79_T	1.329	1.00
23_A	55_E	1.298	1.00
157_E	161_K	1.280	1.00
16_E	20_R	1.263	1.00
53_I	58_G	1.259	1.00
19_K	23_A	1.205	1.00
166_S	172_L	1.202	1.00
61_I	82_I	1.195	1.00
6_V	26_G	1.189	1.00
17_A	21_K	1.173	1.00
115_F	142_M	1.170	1.00
61_I	97_L	1.170	1.00
12_P	19_K	1.161	1.00
24_E	27_V	1.156	1.00
52_A	56_N	1.149	1.00
22_A	104_M	1.147	1.00
6_V	49_I	1.139	1.00
26_G	30_A	1.138	1.00
23_A	27_V	1.130	1.00
15_N	152_E	1.125	1.00
21_K	135_V	1.116	1.00
4_I	29_M	1.110	1.00
102_I	172_L	1.110	1.00
59_T	80_E	1.107	1.00
138_Y	149_S	1.094	1.00
32_Q	174_E	1.093	1.00
21_K	134_N	1.090	1.00
141_P	148_Y	1.082	1.00
93_K	96_E	1.073	1.00
150_I	155_S	1.073	1.00
22_A	26_G	1.065	1.00
24_E	28_Y	1.061	1.00
69_F	74_V	1.047	1.00
24_E	170_D	1.046	1.00
36_L	53_I	1.027	1.00
20_R	24_E	1.022	1.00
150_I	160_L	1.016	1.00
5_C	94_M	1.012	1.00
51_D	55_E	1.008	1.00
4_I	34_I	1.003	1.00
8_A	41_S	1.000	1.00
51_D	77_N	0.998	1.00
140_E	144_K	0.996	1.00
91_K	112_E	0.994	1.00
47_G	51_D	0.994	1.00
63_V	93_K	0.980	1.00
133_Y	172_L	0.972	1.00
64_M	71_G	0.955	0.99
53_I	56_N	0.951	0.99
29_M	36_L	0.936	0.99
75_H	78_L	0.931	0.99
144_K	147_K	0.930	0.99
8_A	49_I	0.929	0.99
132_L	143_M	0.927	0.99
26_G	52_A	0.919	0.99
22_A	45_L	0.911	0.99
53_I	60_A	0.904	0.99
30_A	53_I	0.899	0.99
147_K	151_Q	0.898	0.99
28_Y	173_I	0.897	0.99
25_L	104_M	0.891	0.99
147_K	157_E	0.883	0.99
4_I	100_G	0.876	0.99
27_V	55_E	0.875	0.99
88_H	95_S	0.874	0.99
171_E	175_Q	0.865	0.99
131_G	166_S	0.853	0.99
5_C	101_F	0.844	0.99
66_S	69_F	0.843	0.99
12_P	48_T	0.841	0.99
29_M	53_I	0.840	0.99
26_G	36_L	0.836	0.99
114_L	130_I	0.836	0.99
17_A	20_R	0.822	0.98
121_A	131_G	0.818	0.98
18_Y	154_F	0.816	0.98
108_F	146_V	0.814	0.98
86_G	92_A	0.814	0.98
95_S	101_F	0.813	0.98
121_A	126_H	0.812	0.98
121_A	162_L	0.806	0.98
139_F	145_M	0.806	0.98
104_M	134_N	0.803	0.98
14_G	152_E	0.803	0.98
82_I	97_L	0.801	0.98
61_I	80_E	0.800	0.98
121_A	179_Y	0.799	0.98
111_Y	115_F	0.799	0.98
108_F	155_S	0.798	0.98
145_M	149_S	0.797	0.98
35_G	58_G	0.787	0.98
114_L	163_I	0.784	0.98
95_S	117_V	0.778	0.98
15_N	20_R	0.776	0.98
95_S	120_W	0.774	0.98
12_P	154_F	0.768	0.98
122_Q	159_H	0.766	0.98
174_E	177_Q	0.760	0.97
143_M	163_I	0.757	0.97
52_A	55_E	0.756	0.97
26_G	53_I	0.755	0.97
144_K	148_Y	0.750	0.97
38_Y	60_A	0.750	0.97
64_M	83_E	0.749	0.97
119_C	122_Q	0.744	0.97
118_L	162_L	0.739	0.97
3_T	97_L	0.737	0.97
136_N	140_E	0.721	0.97
13_G	16_E	0.718	0.96
169_P	173_I	0.715	0.96
54_M	60_A	0.712	0.96
88_H	92_A	0.710	0.96
9_G	154_F	0.703	0.96
63_V	94_M	0.699	0.96
145_M	148_Y	0.699	0.96
54_M	75_H	0.696	0.96
158_S	161_K	0.695	0.96
64_M	73_V	0.694	0.96
138_Y	141_P	0.691	0.96
146_V	149_S	0.690	0.96
148_Y	151_Q	0.689	0.95
50_A	60_A	0.688	0.95
118_L	163_I	0.683	0.95
14_G	153_G	0.676	0.95
159_H	162_L	0.673	0.95
111_Y	139_F	0.672	0.95
68_L	72_E	0.668	0.95
112_E	116_E	0.668	0.95
101_F	117_V	0.667	0.95
118_L	146_V	0.665	0.95
18_Y	135_V	0.664	0.95
117_V	121_A	0.663	0.94
41_S	64_M	0.663	0.94
131_G	176_M	0.662	0.94
108_F	159_H	0.662	0.94
34_I	177_Q	0.661	0.94
126_H	129_P	0.656	0.94
27_V	52_A	0.654	0.94
9_G	13_G	0.651	0.94
166_S	169_P	0.648	0.94
134_N	169_P	0.647	0.94
25_L	29_M	0.646	0.94
73_V	78_L	0.646	0.94
6_V	36_L	0.638	0.93
42_R	47_G	0.636	0.93
112_E	119_C	0.635	0.93
88_H	116_E	0.633	0.93
25_L	134_N	0.633	0.93
80_E	97_L	0.633	0.93
167_S	171_E	0.628	0.93
24_E	168_R	0.626	0.93
48_T	51_D	0.625	0.93
6_V	25_L	0.620	0.92
45_L	104_M	0.619	0.92
54_M	77_N	0.617	0.92
115_F	119_C	0.615	0.92
91_K	116_E	0.612	0.92
146_V	160_L	0.603	0.91
103_S	110_T	0.602	0.91
54_M	78_L	0.601	0.91
66_S	83_E	0.600	0.91
171_E	174_E	0.594	0.91
64_M	81_L	0.590	0.90
101_F	129_P	0.584	0.90
9_G	14_G	0.580	0.90
150_I	157_E	0.580	0.90
13_G	153_G	0.579	0.89
65_P	87_M	0.577	0.89
30_A	52_A	0.572	0.89
117_V	129_P	0.567	0.88
98_A	101_F	0.563	0.88
64_M	72_E	0.561	0.88
170_D	174_E	0.557	0.88
21_K	104_M	0.556	0.87
60_A	78_L	0.555	0.87
162_L	179_Y	0.553	0.87
38_Y	50_A	0.552	0.87
95_S	112_E	0.546	0.87
140_E	147_K	0.545	0.86
131_G	173_I	0.545	0.86
119_C	123_I	0.544	0.86
21_K	25_L	0.540	0.86
78_L	81_L	0.539	0.86
120_W	125_I	0.538	0.86
18_Y	45_L	0.536	0.86
94_M	103_S	0.535	0.85
16_E	19_K	0.533	0.85
84_V	93_K	0.532	0.85
143_M	147_K	0.530	0.85
19_K	45_L	0.525	0.84
121_A	127_Q	0.523	0.84
63_V	84_V	0.517	0.83
38_Y	44_G	0.514	0.83
22_A	49_I	0.513	0.83
89_E	92_A	0.513	0.83
116_E	120_W	0.512	0.83
136_N	152_E	0.510	0.83
4_I	102_I	0.508	0.82
3_T	37_V	0.505	0.82
8_A	64_M	0.505	0.82
51_D	54_M	0.504	0.82
114_L	118_L	0.502	0.82
88_H	112_E	0.502	0.82
18_Y	105_P	0.501	0.82
147_K	150_I	0.501	0.82
134_N	172_L	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5ajtA	2	0.9948	100	0.151	Contact Map
1ydhA	2	0.9424	100	0.192	Contact Map
1t35A	5	0.9634	100	0.205	Contact Map
2a33A	2	0.9058	100	0.209	Contact Map
3bq9A	3	0.9634	100	0.233	Contact Map
3gh1A	3	0.9686	100	0.24	Contact Map
3sbxA	2	0.9267	100	0.245	Contact Map
1wekA	5	0.9319	100	0.271	Contact Map
3quaA	2	0.9319	100	0.295	Contact Map
1wehA	1	0.8901	100	0.332	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.