CRH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CRH - HPr-like protein Crh

UniProt:	O06976	Sequences: MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	85 (82)
Sequences:	2796 (1875)
Seq/√Len:	207.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_K	60_E	2.821	1.00
65_A	74_L	2.652	1.00
30_T	68_E	2.427	1.00
4_Q	78_A	2.349	1.00
3_Q	62_T	2.314	1.00
6_V	78_A	2.217	1.00
36_E	64_I	2.083	1.00
25_E	28_R	2.074	1.00
29_F	76_K	2.016	1.00
31_S	69_D	2.010	1.00
34_F	41_K	2.007	1.00
41_K	64_I	1.960	1.00
36_E	41_K	1.960	1.00
36_E	62_T	1.931	1.00
78_A	82_Q	1.824	1.00
5_K	62_T	1.775	1.00
71_Q	75_E	1.724	1.00
3_Q	64_I	1.698	1.00
7_E	60_E	1.647	1.00
37_K	59_T	1.644	1.00
2_V	74_L	1.596	1.00
30_T	69_D	1.577	1.00
25_E	76_K	1.466	1.00
22_F	44_A	1.406	1.00
32_D	66_Q	1.362	1.00
9_R	82_Q	1.359	1.00
2_V	71_Q	1.320	1.00
26_A	77_L	1.307	1.00
75_E	79_A	1.254	1.00
72_E	76_K	1.231	1.00
2_V	70_E	1.200	1.00
22_F	77_L	1.163	1.00
29_F	73_A	1.141	1.00
11_K	57_T	1.138	1.00
4_Q	75_E	1.107	1.00
36_E	39_G	1.033	1.00
22_F	81_V	1.026	1.00
42_V	53_L	1.011	1.00
32_D	43_N	1.010	1.00
1_M	70_E	0.994	1.00
31_S	65_A	0.984	1.00
33_V	73_A	0.974	1.00
72_E	75_E	0.971	1.00
56_S	59_T	0.958	1.00
14_L	22_F	0.952	0.99
21_L	25_E	0.951	0.99
55_V	61_V	0.935	0.99
22_F	35_L	0.915	0.99
8_V	55_V	0.891	0.99
46_S	49_G	0.879	0.99
2_V	65_A	0.867	0.99
69_D	72_E	0.864	0.99
43_N	46_S	0.858	0.99
23_V	47_I	0.852	0.99
6_V	63_L	0.837	0.99
12_T	18_P	0.833	0.99
21_L	24_Q	0.829	0.99
33_V	65_A	0.825	0.99
27_N	49_G	0.797	0.98
10_L	80_Y	0.794	0.98
20_A	51_M	0.788	0.98
26_A	33_V	0.777	0.98
34_F	64_I	0.775	0.98
4_Q	82_Q	0.767	0.98
76_K	79_A	0.758	0.97
29_F	69_D	0.757	0.97
42_V	49_G	0.756	0.97
63_L	81_V	0.753	0.97
21_L	80_Y	0.747	0.97
48_M	52_S	0.732	0.97
25_E	80_Y	0.728	0.97
13_G	19_A	0.728	0.97
20_A	24_Q	0.714	0.96
33_V	44_A	0.713	0.96
16_A	20_A	0.713	0.96
61_V	81_V	0.703	0.96
42_V	48_M	0.687	0.95
26_A	73_A	0.686	0.95
6_V	14_L	0.667	0.95
22_F	63_L	0.666	0.95
34_F	43_N	0.663	0.94
24_Q	28_R	0.662	0.94
69_D	73_A	0.646	0.94
20_A	46_S	0.641	0.93
37_K	55_V	0.638	0.93
18_P	21_L	0.638	0.93
43_N	48_M	0.633	0.93
74_L	78_A	0.632	0.93
26_A	45_K	0.629	0.93
63_L	74_L	0.622	0.92
47_I	51_M	0.612	0.92
13_G	17_R	0.608	0.92
19_A	50_L	0.598	0.91
23_V	50_L	0.592	0.90
47_I	54_A	0.588	0.90
48_M	51_M	0.588	0.90
38_D	59_T	0.585	0.90
6_V	81_V	0.584	0.90
15_Q	18_P	0.576	0.89
27_N	47_I	0.576	0.89
10_L	15_Q	0.575	0.89
63_L	77_L	0.575	0.89
12_T	81_V	0.570	0.89
52_S	55_V	0.566	0.88
16_A	47_I	0.560	0.88
35_L	50_L	0.559	0.88
16_A	48_M	0.557	0.88
15_Q	80_Y	0.557	0.88
11_K	37_K	0.557	0.88
4_Q	74_L	0.556	0.87
6_V	74_L	0.554	0.87
36_E	42_V	0.554	0.87
78_A	81_V	0.550	0.87
10_L	81_V	0.549	0.87
10_L	51_M	0.542	0.86
43_N	49_G	0.539	0.86
19_A	47_I	0.521	0.84
54_A	59_T	0.517	0.83
16_A	23_V	0.508	0.82
18_P	52_S	0.506	0.82
8_V	61_V	0.501	0.82
31_S	70_E	0.501	0.82
8_V	81_V	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1kklH	1	0.9765	100	0.128	Contact Map
3ihsA	1	0.9647	100	0.128	Contact Map
3le1A	1	1	100	0.129	Contact Map
1ka5A	1	1	100	0.129	Contact Map
1ptfA	1	1	100	0.133	Contact Map
1y51A	1	0.9882	100	0.133	Contact Map
1sphA	2	0.9882	100	0.133	Contact Map
3ccdA	2	1	100	0.134	Contact Map
1pchA	1	0.9882	99.9	0.158	Contact Map
2jpiA	1	0.8941	68.9	0.868	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.