YITI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YITI - Uncharacterized N-acetyltransferase YitI

UniProt:	O06744	Sequences: MLEVKTISVEDTYEIRHRILRPHQSIEQCKYKEDHAEGSFHLGVFYDGTLISIASFSPQSQPLLTEASAYRLRGMATLEGYRDQKAGSTLIKHAEHKLAESGVQAVWCNARHHVKGYYAKLGWKELGEPFDIPGIGNHIVMYKTLRTSR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (130)
Sequences:	3777 (2892)
Seq/√Len:	253.6

ECOLI - ELAA YIID
BACSU - YITI YJCF YYBD YYAT
HALSA - Q9HPZ8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
95_E	123_W	2.995	1.00
54_A	94_A	2.650	1.00
115_K	125_E	2.499	1.00
109_N	130_F	2.302	1.00
112_H	129_P	2.257	1.00
52_S	77_T	2.155	1.00
15_I	78_L	2.045	1.00
129_P	137_N	2.019	1.00
93_H	96_H	1.974	1.00
88_S	121_L	1.951	1.00
95_E	143_K	1.912	1.00
44_V	86_A	1.883	1.00
15_I	76_A	1.862	1.00
43_G	50_L	1.826	1.00
91_I	121_L	1.817	1.00
51_I	81_Y	1.807	1.00
45_F	50_L	1.774	1.00
18_R	78_L	1.741	1.00
105_A	142_Y	1.654	1.00
115_K	139_I	1.647	1.00
57_S	73_R	1.634	1.00
119_A	125_E	1.633	1.00
116_G	119_A	1.600	1.00
126_L	140_V	1.597	1.00
59_Q	71_R	1.583	1.00
97_K	101_S	1.581	1.00
11_D	45_F	1.562	1.00
18_R	22_P	1.549	1.00
115_K	119_A	1.543	1.00
72_L	91_I	1.518	1.00
9_V	13_Y	1.518	1.00
126_L	142_Y	1.501	1.00
95_E	106_V	1.471	1.00
97_K	100_E	1.470	1.00
130_F	140_V	1.458	1.00
88_S	92_K	1.447	1.00
53_I	76_A	1.446	1.00
44_V	52_S	1.436	1.00
42_L	97_K	1.427	1.00
14_E	18_R	1.389	1.00
109_N	140_V	1.376	1.00
42_L	94_A	1.371	1.00
131_D	134_G	1.333	1.00
30_K	133_P	1.327	1.00
131_D	137_N	1.322	1.00
54_A	75_M	1.294	1.00
127_G	140_V	1.290	1.00
49_T	80_G	1.289	1.00
17_H	30_K	1.270	1.00
12_T	43_G	1.250	1.00
88_S	120_K	1.249	1.00
46_Y	81_Y	1.246	1.00
109_N	132_I	1.245	1.00
107_W	140_V	1.241	1.00
125_E	139_I	1.234	1.00
12_T	53_I	1.226	1.00
46_Y	51_I	1.216	1.00
40_F	97_K	1.212	1.00
69_A	107_W	1.203	1.00
75_M	91_I	1.191	1.00
89_T	93_H	1.180	1.00
26_I	133_P	1.130	1.00
17_H	28_Q	1.117	1.00
58_P	103_V	1.079	1.00
7_I	11_D	1.072	1.00
40_F	101_S	1.068	1.00
72_L	75_M	1.059	1.00
99_A	143_K	1.056	1.00
17_H	21_R	1.051	1.00
26_I	135_I	1.039	1.00
110_A	141_M	1.023	1.00
56_F	98_L	1.009	1.00
112_H	137_N	1.007	1.00
24_Q	111_R	0.998	1.00
70_Y	103_V	0.997	1.00
54_A	90_L	0.984	1.00
27_E	30_K	0.984	1.00
96_H	100_E	0.980	1.00
81_Y	84_Q	0.979	1.00
18_R	29_C	0.976	1.00
69_A	105_A	0.973	1.00
112_H	115_K	0.959	1.00
114_V	117_Y	0.945	1.00
17_H	22_P	0.923	1.00
93_H	97_K	0.918	1.00
92_K	96_H	0.908	1.00
107_W	142_Y	0.903	1.00
71_R	107_W	0.893	1.00
42_L	54_A	0.872	1.00
52_S	90_L	0.864	1.00
72_L	94_A	0.862	0.99
10_E	13_Y	0.861	0.99
52_S	86_A	0.855	0.99
78_L	81_Y	0.843	0.99
21_R	28_Q	0.837	0.99
45_F	48_G	0.822	0.99
46_Y	49_T	0.822	0.99
51_I	86_A	0.821	0.99
98_L	106_V	0.805	0.99
87_G	117_Y	0.805	0.99
89_T	92_K	0.802	0.99
13_Y	17_H	0.799	0.99
98_L	103_V	0.795	0.99
71_R	109_N	0.794	0.99
111_R	138_H	0.791	0.99
85_K	88_S	0.790	0.99
70_Y	98_L	0.788	0.99
46_Y	84_Q	0.786	0.99
60_S	68_S	0.779	0.99
49_T	78_L	0.772	0.99
33_E	36_A	0.765	0.99
44_V	89_T	0.759	0.99
92_K	121_L	0.748	0.99
71_R	108_C	0.747	0.99
125_E	129_P	0.745	0.99
22_P	27_E	0.743	0.98
13_Y	32_K	0.741	0.98
112_H	139_I	0.727	0.98
56_F	97_K	0.725	0.98
11_D	14_E	0.723	0.98
39_S	57_S	0.722	0.98
72_L	108_C	0.720	0.98
77_T	86_A	0.719	0.98
32_K	35_H	0.715	0.98
18_R	80_G	0.714	0.98
42_L	93_H	0.710	0.98
57_S	71_R	0.704	0.98
106_V	123_W	0.701	0.98
129_P	139_I	0.701	0.98
17_H	31_Y	0.696	0.98
72_L	106_V	0.696	0.98
32_K	36_A	0.688	0.98
56_F	70_Y	0.684	0.97
58_P	61_Q	0.680	0.97
20_L	111_R	0.673	0.97
56_F	94_A	0.668	0.97
96_H	99_A	0.664	0.97
8_S	11_D	0.663	0.97
108_C	141_M	0.660	0.97
55_S	74_G	0.659	0.97
86_A	89_T	0.659	0.97
58_P	70_Y	0.644	0.96
108_C	118_Y	0.637	0.96
115_K	129_P	0.636	0.96
23_H	82_R	0.634	0.96
36_A	39_S	0.629	0.96
42_L	90_L	0.628	0.96
17_H	27_E	0.626	0.96
123_W	143_K	0.619	0.95
9_V	12_T	0.619	0.95
95_E	121_L	0.618	0.95
119_A	124_K	0.617	0.95
84_Q	87_G	0.613	0.95
31_Y	36_A	0.607	0.95
33_E	37_E	0.603	0.95
81_Y	86_A	0.594	0.94
8_S	43_G	0.588	0.94
23_H	74_G	0.588	0.94
35_H	57_S	0.588	0.94
21_R	74_G	0.583	0.94
23_H	79_E	0.578	0.93
60_S	69_A	0.573	0.93
52_S	87_G	0.573	0.93
41_H	53_I	0.567	0.93
10_E	14_E	0.561	0.92
135_I	138_H	0.558	0.92
72_L	123_W	0.554	0.92
108_C	114_V	0.554	0.92
90_L	93_H	0.552	0.92
132_I	135_I	0.551	0.92
15_I	50_L	0.548	0.92
42_L	56_F	0.543	0.91
7_I	37_E	0.542	0.91
14_E	33_E	0.542	0.91
24_Q	138_H	0.540	0.91
61_Q	68_S	0.540	0.91
73_R	111_R	0.539	0.91
20_L	23_H	0.537	0.91
57_S	70_Y	0.532	0.90
73_R	109_N	0.532	0.90
26_I	132_I	0.527	0.90
11_D	50_L	0.527	0.90
18_R	79_E	0.525	0.90
17_H	29_C	0.523	0.90
39_S	58_P	0.522	0.89
26_I	30_K	0.520	0.89
11_D	43_G	0.517	0.89
74_G	82_R	0.512	0.89
20_L	55_S	0.510	0.88
100_E	103_V	0.506	0.88
10_E	31_Y	0.505	0.88
110_A	118_Y	0.503	0.88
92_K	99_A	0.502	0.88
15_I	53_I	0.502	0.88
40_F	56_F	0.500	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jdcA	1	0.9732	99.9	0.4	Contact Map
2g0bA	4	0.9866	99.9	0.437	Contact Map
1kzfA	1	0.8993	99.9	0.444	Contact Map
3p2hA	1	0.9463	99.9	0.45	Contact Map
1ro5A	5	0.9933	99.9	0.451	Contact Map
1xebA	2	0.9262	99.9	0.452	Contact Map
3efaA	2	0.9329	99.9	0.456	Contact Map
1q2yA	1	0.9128	99.9	0.457	Contact Map
1y9wA	2	0.9128	99.8	0.546	Contact Map
3gy9A	3	0.9329	99.7	0.574	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.