COMB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COMB - Probable 2-phosphosulfolactate phosphatase

UniProt:	O06738	Sequences: MPIAIYQGHHHSLAPADINIVIDVIRAFTVAHYAFIGGAKEILLVRTADEAFALKDTYPDYVLTGEEKGVGISGFDLDNSPKRMAGQNMTDKSLIQKTTNGVTAALGALNAKHLFVTGFSNAKTTAQHVKKLVANDCVINIVASHPSGDDDMACAEYIKGIIEGTNVVTAAEAIERIKGSSVAEKFFDCRQPLFDSEDIVYCTKELTGDFVMKVKQDGEVPTIERVII	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	228 (206)
Sequences:	936 (716)
Seq/√Len:	49.9

BACSU - COMB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
123_K	206_L	4.206	1.00
20_I	129_V	4.069	1.00
125_T	212_M	3.295	1.00
186_F	190_R	3.160	1.00
29_T	120_S	3.031	1.00
29_T	202_C	2.852	1.00
80_S	198_D	2.717	1.00
22_I	139_I	2.716	1.00
67_E	97_K	2.627	1.00
186_F	189_C	2.545	1.00
197_E	200_V	2.500	1.00
51_A	95_I	2.398	1.00
113_H	213_K	2.240	1.00
64_T	84_M	2.238	1.00
117_T	158_I	2.227	1.00
43_L	93_S	2.172	1.00
41_E	93_S	2.081	1.00
159_K	171_A	2.073	1.00
26_R	79_N	2.039	1.00
115_F	128_H	2.032	1.00
34_A	94_L	1.934	0.99
114_L	214_V	1.889	0.99
204_K	207_T	1.874	0.99
20_I	125_T	1.852	0.99
182_V	189_C	1.848	0.99
36_I	208_G	1.769	0.99
45_V	95_I	1.766	0.99
120_S	208_G	1.754	0.99
18_I	129_V	1.677	0.98
122_A	157_Y	1.673	0.98
119_F	153_A	1.636	0.98
31_A	96_Q	1.630	0.98
161_I	206_L	1.630	0.98
17_D	138_V	1.629	0.98
125_T	211_V	1.614	0.98
28_F	116_V	1.579	0.97
186_F	191_Q	1.565	0.97
26_R	198_D	1.560	0.97
25_I	203_T	1.554	0.97
78_D	83_R	1.530	0.97
113_H	132_L	1.523	0.97
31_A	42_I	1.516	0.97
33_Y	201_Y	1.509	0.97
48_A	97_K	1.503	0.97
124_T	211_V	1.503	0.97
185_K	189_C	1.468	0.96
182_V	191_Q	1.468	0.96
77_L	88_N	1.441	0.96
117_T	125_T	1.429	0.95
187_F	190_R	1.394	0.95
129_V	137_C	1.369	0.94
160_G	179_G	1.368	0.94
55_K	76_D	1.362	0.94
178_K	205_E	1.359	0.94
20_I	139_I	1.344	0.94
129_V	158_I	1.342	0.94
54_L	95_I	1.342	0.94
26_R	80_S	1.330	0.93
115_F	132_L	1.325	0.93
130_K	162_I	1.320	0.93
52_F	55_K	1.315	0.93
117_T	129_V	1.311	0.93
152_M	174_I	1.305	0.93
63_L	72_I	1.295	0.92
139_I	158_I	1.291	0.92
168_V	171_A	1.286	0.92
123_K	127_Q	1.265	0.91
28_F	142_V	1.245	0.91
98_T	102_V	1.242	0.91
24_V	154_C	1.238	0.91
214_V	219_E	1.231	0.90
128_H	132_L	1.228	0.90
34_A	39_A	1.224	0.90
79_N	198_D	1.203	0.89
125_T	158_I	1.201	0.89
115_F	125_T	1.191	0.89
32_H	120_S	1.188	0.89
154_C	158_I	1.175	0.88
32_H	118_G	1.165	0.88
182_V	186_F	1.154	0.87
116_V	219_E	1.153	0.87
186_F	203_T	1.128	0.86
30_V	84_M	1.127	0.86
32_H	116_V	1.116	0.85
112_K	134_A	1.115	0.85
169_T	178_K	1.114	0.85
216_Q	219_E	1.113	0.85
201_Y	208_G	1.110	0.85
182_V	185_K	1.107	0.85
111_A	114_L	1.102	0.85
123_K	161_I	1.090	0.84
26_R	202_C	1.083	0.83
127_Q	131_K	1.080	0.83
24_V	116_V	1.072	0.83
27_A	102_V	1.071	0.83
21_V	108_A	1.067	0.83
183_A	186_F	1.053	0.82
47_T	50_E	1.053	0.82
79_N	202_C	1.049	0.81
62_V	77_L	1.048	0.81
108_A	140_N	1.045	0.81
100_N	121_N	1.043	0.81
19_N	138_V	1.038	0.81
37_G	89_M	1.037	0.81
127_Q	130_K	1.027	0.80
187_F	191_Q	1.017	0.79
21_V	28_F	1.015	0.79
22_I	155_A	0.962	0.75
149_D	173_A	0.962	0.75
119_F	154_C	0.962	0.75
17_D	135_N	0.960	0.75
27_A	98_T	0.955	0.75
34_A	44_L	0.955	0.75
55_K	59_P	0.952	0.75
42_I	114_L	0.951	0.75
71_G	83_R	0.941	0.74
149_D	156_E	0.940	0.74
156_E	174_I	0.940	0.74
80_S	202_C	0.939	0.74
175_E	179_G	0.933	0.73
76_D	79_N	0.932	0.73
86_G	90_T	0.931	0.73
88_N	92_K	0.930	0.73
30_V	150_D	0.927	0.73
106_L	109_L	0.927	0.73
30_V	65_G	0.924	0.72
53_A	165_T	0.899	0.70
30_V	35_F	0.898	0.70
104_A	142_V	0.896	0.70
129_V	132_L	0.893	0.70
21_V	128_H	0.889	0.70
141_I	155_A	0.877	0.68
45_V	51_A	0.874	0.68
22_I	154_C	0.873	0.68
64_T	94_L	0.867	0.68
174_I	178_K	0.867	0.68
182_V	187_F	0.867	0.68
28_F	31_A	0.866	0.68
144_S	148_G	0.861	0.67
31_A	212_M	0.860	0.67
115_F	129_V	0.858	0.67
19_N	111_A	0.855	0.67
24_V	119_F	0.855	0.67
45_V	54_L	0.850	0.66
173_A	177_I	0.845	0.66
100_N	142_V	0.843	0.65
35_F	210_F	0.841	0.65
60_D	64_T	0.840	0.65
159_K	175_E	0.834	0.65
40_K	93_S	0.833	0.64
53_A	57_T	0.830	0.64
39_A	89_M	0.824	0.64
28_F	174_I	0.822	0.63
16_A	19_N	0.816	0.63
156_E	178_K	0.816	0.63
20_I	115_F	0.815	0.63
41_E	218_G	0.813	0.63
35_F	212_M	0.813	0.63
127_Q	165_T	0.809	0.62
181_S	187_F	0.802	0.62
27_A	66_E	0.800	0.61
33_Y	84_M	0.792	0.61
66_E	75_F	0.790	0.60
185_K	191_Q	0.787	0.60
26_R	67_E	0.786	0.60
81_P	151_D	0.786	0.60
36_I	94_L	0.782	0.60
156_E	159_K	0.778	0.59
65_G	83_R	0.775	0.59
65_G	72_I	0.773	0.59
157_Y	178_K	0.772	0.59
20_I	117_T	0.766	0.58
128_H	213_K	0.766	0.58
67_E	79_N	0.765	0.58
42_I	96_Q	0.758	0.57
31_A	116_V	0.758	0.57
184_E	190_R	0.756	0.57
22_I	63_L	0.755	0.57
65_G	75_F	0.755	0.57
66_E	102_V	0.751	0.56
35_F	65_G	0.749	0.56
63_L	75_F	0.746	0.56
184_E	189_C	0.737	0.55
52_F	56_D	0.735	0.55
109_L	114_L	0.732	0.55
184_E	187_F	0.730	0.54
32_H	208_G	0.722	0.54
160_G	172_E	0.721	0.53
160_G	175_E	0.707	0.52
21_V	44_L	0.706	0.52
29_T	71_G	0.706	0.52
200_V	204_K	0.702	0.51
44_L	139_I	0.700	0.51
55_K	63_L	0.699	0.51
117_T	206_L	0.696	0.51
74_G	94_L	0.688	0.50
101_G	150_D	0.682	0.49
14_A	112_K	0.680	0.49
122_A	206_L	0.675	0.49
26_R	144_S	0.674	0.49
105_A	108_A	0.671	0.48
126_A	154_C	0.671	0.48
198_D	202_C	0.666	0.48
34_A	64_T	0.659	0.47
72_I	75_F	0.658	0.47
129_V	218_G	0.658	0.47
31_A	105_A	0.657	0.47
128_H	211_V	0.656	0.47
33_Y	37_G	0.652	0.46
39_A	94_L	0.649	0.46
130_K	164_G	0.649	0.46
25_I	202_C	0.646	0.46
62_V	89_M	0.645	0.46
99_T	146_P	0.643	0.45
71_G	199_I	0.643	0.45
82_K	85_A	0.640	0.45
50_E	53_A	0.638	0.45
52_F	75_F	0.636	0.45
17_D	178_K	0.635	0.45
100_N	104_A	0.634	0.45
157_Y	161_I	0.633	0.44
42_I	62_V	0.632	0.44
108_A	114_L	0.629	0.44
182_V	190_R	0.628	0.44
149_D	152_M	0.625	0.44
184_E	188_D	0.623	0.43
154_C	202_C	0.620	0.43
105_A	214_V	0.616	0.43
83_R	194_F	0.615	0.43
144_S	157_Y	0.615	0.43
163_E	175_E	0.615	0.43
160_G	163_E	0.613	0.42
35_F	42_I	0.613	0.42
115_F	202_C	0.612	0.42
28_F	117_T	0.612	0.42
99_T	102_V	0.610	0.42
141_I	169_T	0.609	0.42
43_L	95_I	0.609	0.42
28_F	194_F	0.607	0.42
154_C	157_Y	0.607	0.42
149_D	153_A	0.606	0.42
196_S	199_I	0.606	0.42
26_R	76_D	0.606	0.42
35_F	39_A	0.601	0.41
53_A	56_D	0.598	0.41
133_V	159_K	0.593	0.40
69_G	74_G	0.590	0.40
141_I	149_D	0.589	0.40
174_I	177_I	0.588	0.40
152_M	177_I	0.586	0.40
84_M	89_M	0.586	0.40
66_E	69_G	0.584	0.40
19_N	102_V	0.583	0.39
157_Y	205_E	0.579	0.39
183_A	190_R	0.575	0.39
41_E	197_E	0.575	0.39
85_A	88_N	0.575	0.39
66_E	99_T	0.574	0.39
74_G	83_R	0.574	0.39
119_F	126_A	0.573	0.38
20_I	126_A	0.573	0.38
82_K	197_E	0.572	0.38
20_I	218_G	0.572	0.38
142_V	194_F	0.566	0.38
173_A	200_V	0.566	0.38
122_A	154_C	0.565	0.38
92_K	104_A	0.561	0.37
104_A	141_I	0.559	0.37
27_A	99_T	0.559	0.37
26_R	83_R	0.557	0.37
145_H	197_E	0.557	0.37
20_I	173_A	0.557	0.37
101_G	151_D	0.555	0.37
103_T	137_C	0.552	0.36
52_F	71_G	0.551	0.36
29_T	203_T	0.550	0.36
139_I	187_F	0.547	0.36
28_F	169_T	0.547	0.36
119_F	203_T	0.547	0.36
99_T	138_V	0.546	0.36
100_N	156_E	0.546	0.36
46_R	103_T	0.545	0.36
28_F	100_N	0.544	0.36
130_K	165_T	0.537	0.35
52_F	127_Q	0.537	0.35
52_F	158_I	0.536	0.35
76_D	80_S	0.533	0.35
47_T	97_K	0.531	0.35
105_A	116_V	0.530	0.34
40_K	43_L	0.522	0.34
133_V	209_D	0.520	0.33
86_G	89_M	0.520	0.33
159_K	195_D	0.519	0.33
81_P	101_G	0.518	0.33
126_A	158_I	0.518	0.33
22_I	62_V	0.516	0.33
114_L	193_L	0.514	0.33
125_T	129_V	0.514	0.33
122_A	129_V	0.514	0.33
149_D	211_V	0.511	0.33
33_Y	120_S	0.509	0.32
45_V	105_A	0.509	0.32
134_A	209_D	0.506	0.32
20_I	158_I	0.506	0.32
171_A	211_V	0.505	0.32
78_D	152_M	0.505	0.32
51_A	152_M	0.503	0.32
77_L	94_L	0.502	0.32
100_N	195_D	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vr0A	2	0.9605	100	0.145	Contact Map
2z0jA	3	0.9825	100	0.17	Contact Map
2yyvA	2	0.9298	100	0.176	Contact Map
2z5eA	2	0.5088	18.5	0.959	Contact Map
4au1A	2	0.6272	17.1	0.96	Contact Map
3e7dA	2	0.636	11.7	0.962	Contact Map
1v9cA	2	0.6667	11.6	0.962	Contact Map
2p10A	5	0.7675	11.6	0.962	Contact Map
1f2vA	2	0.6404	10	0.964	Contact Map
2j48A	1	0.5	8.5	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.