YISL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YISL - UPF0344 protein YisL

UniProt:	O06725	Sequences: MTHLHITTWVVALILLFVSYSLYSSGSAKGAKITHMILRLFYILIILTGAELFVRFANWNGEYAGKMILGIITIGLMEMLLIRKKKEKSTGGLWVGFVIVLLLTVLLGLHLPIGFQLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	118 (113)
Sequences:	194 (152)
Seq/√Len:	14.3

BACSU - YISL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_I	96_G	4.336	1.00
12_A	45_I	3.170	0.98
24_S	84_K	2.787	0.96
82_I	86_K	2.616	0.94
12_A	38_L	2.594	0.94
96_G	100_V	2.312	0.90
53_F	67_M	2.310	0.89
18_V	22_L	2.208	0.87
4_L	48_T	2.162	0.86
72_I	76_L	2.111	0.85
35_H	82_I	2.101	0.84
8_T	44_L	2.011	0.82
19_S	34_T	1.951	0.79
19_S	81_L	1.945	0.79
92_G	96_G	1.803	0.74
11_V	41_F	1.793	0.73
21_S	25_S	1.721	0.70
23_Y	35_H	1.690	0.69
3_H	7_T	1.647	0.67
61_G	64_A	1.603	0.64
75_G	83_R	1.601	0.64
29_K	33_I	1.510	0.60
20_Y	102_L	1.485	0.58
15_L	74_I	1.464	0.57
48_T	68_I	1.456	0.57
75_G	79_M	1.456	0.57
33_I	37_I	1.445	0.56
22_L	34_T	1.423	0.55
50_A	54_V	1.401	0.54
80_L	94_W	1.385	0.53
20_Y	35_H	1.375	0.52
41_F	47_L	1.360	0.51
62_E	110_H	1.309	0.49
14_I	18_V	1.301	0.48
72_I	100_V	1.300	0.48
69_L	100_V	1.273	0.47
69_L	104_T	1.270	0.47
43_I	47_L	1.222	0.44
25_S	95_V	1.211	0.43
43_I	46_I	1.175	0.41
69_L	107_L	1.171	0.41
11_V	69_L	1.149	0.40
69_L	103_L	1.137	0.39
53_F	64_A	1.120	0.39
30_G	84_K	1.118	0.38
23_Y	31_A	1.115	0.38
48_T	88_K	1.107	0.38
65_G	85_K	1.097	0.37
111_L	114_G	1.082	0.37
82_I	88_K	1.073	0.36
17_F	106_L	1.071	0.36
73_T	104_T	1.065	0.36
15_L	38_L	1.059	0.35
72_I	91_G	1.047	0.35
67_M	97_F	1.042	0.35
61_G	65_G	1.031	0.34
6_I	9_W	1.022	0.34
99_I	109_L	1.017	0.33
80_L	93_L	1.014	0.33
42_Y	74_I	1.009	0.33
45_I	70_G	0.991	0.32
70_G	73_T	0.990	0.32
68_I	71_I	0.982	0.32
6_I	70_G	0.965	0.31
70_G	111_L	0.959	0.31
90_T	98_V	0.946	0.30
65_G	89_S	0.927	0.29
30_G	33_I	0.917	0.29
26_G	32_K	0.913	0.28
91_G	95_V	0.913	0.28
6_I	112_P	0.899	0.28
46_I	63_Y	0.895	0.28
44_L	48_T	0.883	0.27
40_L	69_L	0.880	0.27
42_Y	82_I	0.877	0.27
7_T	70_G	0.868	0.26
57_A	64_A	0.867	0.26
55_R	71_I	0.853	0.26
76_L	93_L	0.845	0.26
23_Y	43_I	0.844	0.25
46_I	109_L	0.836	0.25
64_A	68_I	0.820	0.25
19_S	97_F	0.813	0.24
64_A	67_M	0.809	0.24
72_I	79_M	0.802	0.24
47_L	50_A	0.800	0.24
65_G	68_I	0.788	0.23
2_T	109_L	0.782	0.23
48_T	65_G	0.774	0.23
98_V	102_L	0.773	0.23
8_T	11_V	0.771	0.23
62_E	107_L	0.766	0.22
99_I	103_L	0.765	0.22
3_H	32_K	0.764	0.22
20_Y	106_L	0.754	0.22
84_K	98_V	0.753	0.22
79_M	82_I	0.751	0.22
8_T	83_R	0.745	0.22
55_R	58_N	0.745	0.22
34_T	71_I	0.740	0.21
11_V	26_G	0.731	0.21
32_K	40_L	0.730	0.21
20_Y	23_Y	0.726	0.21
17_F	21_S	0.713	0.20
32_K	52_L	0.703	0.20
11_V	75_G	0.702	0.20
29_K	64_A	0.701	0.20
83_R	88_K	0.695	0.20
89_S	93_L	0.688	0.20
105_V	110_H	0.686	0.19
8_T	87_E	0.683	0.19
44_L	97_F	0.680	0.19
44_L	95_V	0.675	0.19
6_I	111_L	0.673	0.19
80_L	106_L	0.669	0.19
27_S	33_I	0.668	0.19
34_T	60_N	0.661	0.19
48_T	112_P	0.654	0.18
19_S	85_K	0.649	0.18
27_S	91_G	0.646	0.18
22_L	30_G	0.646	0.18
51_E	64_A	0.641	0.18
8_T	60_N	0.631	0.18
37_I	42_Y	0.631	0.18
83_R	92_G	0.626	0.17
10_V	85_K	0.617	0.17
86_K	114_G	0.615	0.17
3_H	10_V	0.615	0.17
58_N	98_V	0.611	0.17
36_M	40_L	0.610	0.17
48_T	86_K	0.610	0.17
94_W	97_F	0.607	0.17
84_K	91_G	0.604	0.17
56_F	103_L	0.604	0.17
62_E	69_L	0.602	0.17
107_L	110_H	0.598	0.17
33_I	52_L	0.598	0.17
40_L	74_I	0.596	0.17
62_E	105_V	0.592	0.16
58_N	89_S	0.590	0.16
35_H	61_G	0.587	0.16
4_L	70_G	0.587	0.16
90_T	94_W	0.587	0.16
81_L	95_V	0.582	0.16
43_I	56_F	0.574	0.16
18_V	68_I	0.572	0.16
23_Y	89_S	0.571	0.16
40_L	68_I	0.571	0.16
76_L	90_T	0.570	0.16
24_S	28_A	0.567	0.16
4_L	52_L	0.562	0.16
50_A	57_A	0.562	0.16
45_I	56_F	0.561	0.16
92_G	100_V	0.553	0.15
25_S	103_L	0.552	0.15
54_V	103_L	0.551	0.15
34_T	40_L	0.542	0.15
2_T	52_L	0.540	0.15
2_T	95_V	0.537	0.15
31_A	35_H	0.535	0.15
75_G	93_L	0.533	0.15
106_L	110_H	0.528	0.15
25_S	72_I	0.526	0.15
16_L	19_S	0.524	0.14
65_G	90_T	0.518	0.14
31_A	53_F	0.517	0.14
69_L	72_I	0.507	0.14
24_S	27_S	0.501	0.14
4_L	54_V	0.500	0.14
16_L	77_M	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ogqG	1	0.2627	14.4	0.937	Contact Map
1q90G	1	0.2034	11.4	0.94	Contact Map
3owqA	1	0	6.9	0.945	Contact Map
1skhA	1	0.2288	5.2	0.949	Contact Map
3rlfG	1	0.2542	4.7	0.949	Contact Map
4o6yA	2	1	3.3	0.953	Contact Map
4pd6A	3	0.4068	3.1	0.954	Contact Map
3cx5C	2	0.8136	2.5	0.956	Contact Map
4p02A	1	0.678	2.2	0.957	Contact Map
2akhX	1	0.2458	2.2	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.