GERPE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GERPE - Probable spore germination protein GerPE

UniProt:	O06717	Sequences: MLKRISRIRLVKFNSLGIASVFQVGDTNEIDMSVKVFAVQRSLSTFYHNEGSFNKKEYQIFQQQAVKPLPETGVQSAFCHEVPAIYVRSIKIQGVSASSVLHAGSASLIRGDARLKHIRQIQSPRSQSPAKNI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (121)
Sequences:	128 (104)
Seq/√Len:	9.4

BACSU - GERPE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_T	102_H	3.232	0.94
13_F	16_L	2.752	0.87
53_F	61_F	2.667	0.86
8_I	103_A	2.615	0.85
32_M	111_G	2.613	0.84
15_S	18_I	2.478	0.81
30_I	100_V	2.477	0.81
105_S	111_G	2.274	0.75
42_S	122_Q	2.233	0.73
51_G	120_Q	2.200	0.72
95_V	99_S	2.170	0.71
6_S	105_S	2.147	0.70
41_R	50_E	2.073	0.68
35_K	57_E	2.066	0.67
6_S	103_A	2.051	0.67
41_R	120_Q	1.983	0.64
20_S	96_S	1.941	0.62
50_E	120_Q	1.925	0.62
19_A	23_Q	1.799	0.56
5_I	68_P	1.792	0.56
23_Q	102_H	1.662	0.50
24_V	111_G	1.633	0.49
62_Q	113_A	1.606	0.48
41_R	51_G	1.598	0.47
99_S	116_K	1.586	0.47
65_A	112_D	1.492	0.42
34_V	123_S	1.467	0.41
24_V	116_K	1.455	0.41
80_H	105_S	1.440	0.40
4_R	40_Q	1.420	0.39
31_D	90_I	1.418	0.39
17_G	36_V	1.415	0.39
35_K	115_L	1.376	0.38
36_V	97_A	1.345	0.36
35_K	81_E	1.343	0.36
13_F	56_K	1.340	0.36
97_A	118_I	1.321	0.35
24_V	78_F	1.303	0.35
6_S	50_E	1.284	0.34
6_S	83_P	1.269	0.33
69_L	117_H	1.260	0.33
44_S	120_Q	1.257	0.33
52_S	62_Q	1.241	0.32
74_V	90_I	1.229	0.32
94_G	99_S	1.207	0.31
60_I	95_V	1.201	0.31
102_H	106_A	1.134	0.28
27_T	46_F	1.108	0.27
20_S	115_L	1.108	0.27
20_S	80_H	1.094	0.27
11_V	22_F	1.090	0.27
56_K	107_S	1.078	0.26
17_G	60_I	1.071	0.26
27_T	106_A	1.071	0.26
8_I	24_V	1.068	0.26
17_G	97_A	1.000	0.24
101_L	105_S	0.997	0.23
42_S	121_I	0.995	0.23
102_H	109_I	0.985	0.23
8_I	65_A	0.978	0.23
2_L	23_Q	0.961	0.22
53_F	58_Y	0.959	0.22
63_Q	112_D	0.956	0.22
80_H	88_R	0.952	0.22
96_S	117_H	0.950	0.22
74_V	91_K	0.948	0.22
34_V	62_Q	0.943	0.22
5_I	90_I	0.934	0.21
4_R	112_D	0.921	0.21
65_A	118_I	0.918	0.21
35_K	69_L	0.913	0.21
37_F	56_K	0.904	0.21
42_S	77_A	0.885	0.20
5_I	49_N	0.882	0.20
36_V	115_L	0.881	0.20
73_G	92_I	0.879	0.20
48_H	51_G	0.878	0.20
94_G	121_I	0.861	0.19
80_H	95_V	0.860	0.19
88_R	107_S	0.856	0.19
24_V	75_Q	0.856	0.19
46_F	113_A	0.846	0.19
116_K	122_Q	0.844	0.19
39_V	49_N	0.844	0.19
70_P	74_V	0.844	0.19
8_I	66_V	0.829	0.18
111_G	117_H	0.823	0.18
25_G	104_G	0.820	0.18
104_G	119_R	0.820	0.18
25_G	119_R	0.820	0.18
14_N	107_S	0.819	0.18
67_K	80_H	0.816	0.18
48_H	107_S	0.813	0.18
41_R	47_Y	0.813	0.18
74_V	77_A	0.812	0.18
66_V	121_I	0.807	0.18
30_I	111_G	0.789	0.17
17_G	99_S	0.780	0.17
12_K	80_H	0.779	0.17
41_R	83_P	0.779	0.17
23_Q	33_S	0.776	0.17
21_V	103_A	0.774	0.17
43_L	120_Q	0.772	0.17
27_T	44_S	0.753	0.17
92_I	98_S	0.747	0.16
37_F	117_H	0.743	0.16
21_V	102_H	0.737	0.16
52_S	109_I	0.736	0.16
17_G	94_G	0.735	0.16
49_N	102_H	0.730	0.16
81_E	111_G	0.729	0.16
13_F	124_P	0.720	0.16
59_Q	110_R	0.717	0.16
19_A	38_A	0.716	0.16
63_Q	100_V	0.709	0.15
97_A	110_R	0.709	0.15
13_F	108_L	0.707	0.15
8_I	46_F	0.704	0.15
16_L	22_F	0.700	0.15
40_Q	95_V	0.699	0.15
11_V	14_N	0.696	0.15
95_V	101_L	0.693	0.15
15_S	42_S	0.690	0.15
9_R	69_L	0.690	0.15
44_S	70_P	0.684	0.15
59_Q	116_K	0.677	0.15
38_A	117_H	0.672	0.15
92_I	96_S	0.667	0.15
15_S	56_K	0.662	0.14
58_Y	121_I	0.655	0.14
65_A	114_R	0.651	0.14
4_R	38_A	0.651	0.14
77_A	101_L	0.648	0.14
32_M	112_D	0.647	0.14
20_S	38_A	0.639	0.14
87_V	92_I	0.631	0.14
21_V	109_I	0.630	0.14
5_I	22_F	0.628	0.14
81_E	105_S	0.627	0.14
17_G	98_S	0.621	0.14
18_I	100_V	0.618	0.13
23_Q	30_I	0.616	0.13
58_Y	65_A	0.614	0.13
37_F	51_G	0.603	0.13
9_R	117_H	0.601	0.13
42_S	45_T	0.597	0.13
82_V	113_A	0.596	0.13
24_V	28_N	0.596	0.13
52_S	56_K	0.594	0.13
40_Q	59_Q	0.589	0.13
15_S	27_T	0.586	0.13
62_Q	89_S	0.584	0.13
26_D	117_H	0.576	0.13
69_L	72_T	0.574	0.13
21_V	89_S	0.573	0.13
49_N	109_I	0.562	0.12
102_H	121_I	0.558	0.12
66_V	118_I	0.556	0.12
18_I	58_Y	0.555	0.12
53_F	57_E	0.555	0.12
59_Q	80_H	0.547	0.12
65_A	115_L	0.545	0.12
16_L	46_F	0.545	0.12
91_K	108_L	0.544	0.12
76_S	100_V	0.543	0.12
21_V	58_Y	0.534	0.12
10_L	110_R	0.533	0.12
41_R	118_I	0.532	0.12
20_S	47_Y	0.531	0.12
46_F	50_E	0.528	0.12
20_S	76_S	0.521	0.12
49_N	73_G	0.520	0.12
16_L	71_E	0.516	0.11
27_T	30_I	0.516	0.11
6_S	85_I	0.509	0.11
71_E	90_I	0.509	0.11
11_V	90_I	0.508	0.11
19_A	37_F	0.508	0.11
110_R	115_L	0.505	0.11
24_V	81_E	0.503	0.11
39_V	93_Q	0.500	0.11
18_I	93_Q	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4dynA	3	0.3534	9.7	0.948	Contact Map
4uebB	1	0.3083	4.7	0.955	Contact Map
3tj0A	3	0.3158	4.7	0.955	Contact Map
2nr5A	4	0.2857	2	0.963	Contact Map
4s39A	2	0.4211	1.8	0.964	Contact Map
5a1uG	1	0.1955	1.8	0.964	Contact Map
4i5tA	2	0.4361	1.7	0.964	Contact Map
2heoA	1	0.1654	1.5	0.965	Contact Map
1rkiA	1	0.2782	1.5	0.965	Contact Map
3bp3A	1	0.3684	1.4	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.