YISB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YISB - Uncharacterized protein YisB

UniProt:	O06715	Sequences: MAKQIAGICELCGRSDVQLTEHHLTPKEEGGTFLPTAMLCIPCHKQIHALYTNQELAVRLNGMAELRSDPELARFVKWIRKQPPEKLIKTKKSNERKKKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	100 (85)
Sequences:	341 (248)
Seq/√Len:	26.9

BACSU - YISB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_T	55_E	4.576	1.00
51_Y	69_D	3.097	1.00
46_Q	50_L	2.651	0.99
41_I	45_K	2.204	0.98
20_T	40_C	2.098	0.97
29_E	54_Q	1.891	0.94
51_Y	60_L	1.784	0.92
50_L	60_L	1.768	0.92
82_Q	86_K	1.715	0.91
27_K	31_G	1.670	0.90
67_R	76_V	1.635	0.89
25_T	71_E	1.625	0.88
44_H	48_H	1.599	0.87
65_E	68_S	1.564	0.86
67_R	74_R	1.532	0.85
63_M	67_R	1.527	0.85
10_E	20_T	1.524	0.85
60_L	69_D	1.517	0.84
68_S	80_R	1.457	0.82
42_P	79_I	1.428	0.81
10_E	24_L	1.424	0.80
30_G	39_L	1.389	0.79
9_C	14_R	1.378	0.78
53_N	86_K	1.340	0.76
41_I	53_N	1.320	0.75
51_Y	72_L	1.313	0.75
9_C	12_C	1.267	0.72
20_T	53_N	1.246	0.71
20_T	41_I	1.217	0.69
27_K	32_T	1.215	0.69
10_E	40_C	1.192	0.67
72_L	76_V	1.185	0.67
49_A	90_T	1.128	0.63
51_Y	56_L	1.091	0.60
46_Q	72_L	1.089	0.60
40_C	88_I	1.086	0.60
24_L	62_G	1.054	0.57
16_D	27_K	1.050	0.57
25_T	32_T	1.039	0.56
40_C	86_K	1.036	0.56
28_E	53_N	1.032	0.56
20_T	30_G	1.029	0.56
52_T	93_S	1.017	0.55
45_K	87_L	1.012	0.54
42_P	88_I	1.006	0.54
11_L	72_L	1.003	0.54
13_G	80_R	0.996	0.53
21_E	38_M	0.994	0.53
45_K	92_K	0.975	0.52
10_E	88_I	0.971	0.51
57_A	74_R	0.949	0.50
25_T	61_N	0.943	0.49
68_S	73_A	0.927	0.48
70_P	73_A	0.923	0.48
52_T	74_R	0.921	0.48
37_A	63_M	0.919	0.47
30_G	83_P	0.914	0.47
31_G	49_A	0.911	0.47
30_G	77_K	0.902	0.46
55_E	59_R	0.895	0.46
50_L	69_D	0.889	0.45
10_E	37_A	0.870	0.44
17_V	81_K	0.868	0.44
30_G	36_T	0.867	0.44
11_L	14_R	0.862	0.43
71_E	74_R	0.857	0.43
42_P	87_L	0.831	0.41
47_I	64_A	0.831	0.41
44_H	47_I	0.824	0.40
40_C	82_Q	0.816	0.40
41_I	87_L	0.814	0.40
51_Y	66_L	0.808	0.39
20_T	88_I	0.794	0.38
56_L	61_N	0.780	0.37
50_L	71_E	0.768	0.36
24_L	60_L	0.767	0.36
25_T	35_P	0.762	0.36
18_Q	73_A	0.756	0.36
59_R	65_E	0.756	0.36
15_S	86_K	0.755	0.35
75_F	78_W	0.753	0.35
8_I	77_K	0.746	0.35
25_T	83_P	0.741	0.35
73_A	77_K	0.738	0.34
74_R	81_K	0.732	0.34
40_C	53_N	0.727	0.34
21_E	82_Q	0.720	0.33
19_L	38_M	0.718	0.33
45_K	91_K	0.707	0.32
16_D	19_L	0.701	0.32
68_S	85_E	0.697	0.32
56_L	63_M	0.696	0.32
55_E	69_D	0.691	0.31
78_W	86_K	0.684	0.31
65_E	70_P	0.680	0.31
17_V	27_K	0.673	0.30
57_A	61_N	0.673	0.30
10_E	42_P	0.646	0.28
15_S	84_P	0.645	0.28
20_T	42_P	0.644	0.28
28_E	37_A	0.631	0.27
18_Q	85_E	0.629	0.27
20_T	24_L	0.624	0.27
13_G	47_I	0.615	0.27
28_E	75_F	0.601	0.26
10_E	53_N	0.597	0.25
82_Q	85_E	0.586	0.25
11_L	66_L	0.579	0.24
21_E	41_I	0.579	0.24
62_G	93_S	0.563	0.24
71_E	91_K	0.560	0.23
61_N	65_E	0.559	0.23
56_L	65_E	0.559	0.23
7_G	25_T	0.547	0.23
32_T	84_P	0.545	0.23
80_R	87_L	0.543	0.23
76_V	89_K	0.539	0.22
35_P	42_P	0.535	0.22
78_W	84_P	0.532	0.22
21_E	45_K	0.528	0.22
75_F	89_K	0.523	0.21
38_M	50_L	0.519	0.21
70_P	75_F	0.517	0.21
53_N	89_K	0.516	0.21
8_I	72_L	0.514	0.21
42_P	86_K	0.509	0.21
35_P	52_T	0.506	0.21
64_A	67_R	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ogeA	1	0.91	97.9	0.797	Contact Map
4h9dA	3	0.64	97	0.828	Contact Map
4un4B	1	0.85	95.9	0.847	Contact Map
3m7kA	2	0.71	94.6	0.858	Contact Map
3plwA	1	0.75	84.5	0.888	Contact Map
4uhqA	1	0.56	75.3	0.898	Contact Map
1e7lA	2	0.93	64.7	0.905	Contact Map
3goxA	2	0.61	56.6	0.91	Contact Map
3g27A	2	0.67	52.5	0.912	Contact Map
1k3xA	1	0.34	42.9	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.