GATC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GATC - Glutamyl-tRNA(Gln) amidotransferase subunit C

UniProt:	O06492	Sequences: MSRISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVMREDEAGKGLPVEDVMKNAPDHKDGYIRVPSILD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	96 (93)
Sequences:	2338 (1460)
Seq/√Len:	151.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_K	25_A	3.716	1.00
73_P	76_D	3.102	1.00
6_I	26_K	2.903	1.00
72_L	77_V	2.892	1.00
5_S	8_E	2.794	1.00
83_D	90_R	2.703	1.00
21_T	24_E	2.619	1.00
74_V	87_G	2.522	1.00
7_E	10_K	2.221	1.00
73_P	77_V	1.963	1.00
6_I	10_K	1.958	1.00
6_I	25_A	1.917	1.00
77_V	89_I	1.878	1.00
76_D	79_K	1.853	1.00
28_F	31_Q	1.842	1.00
33_D	37_S	1.829	1.00
20_I	25_A	1.764	1.00
78_M	84_H	1.726	1.00
55_H	59_M	1.725	1.00
84_H	87_G	1.710	1.00
26_K	29_T	1.516	1.00
27_M	31_Q	1.510	1.00
46_N	49_N	1.474	1.00
40_E	43_N	1.393	1.00
31_Q	34_S	1.362	1.00
22_E	25_A	1.359	1.00
20_I	28_F	1.354	1.00
70_K	73_P	1.354	1.00
68_A	71_G	1.307	1.00
53_T	56_V	1.293	1.00
33_D	36_I	1.293	1.00
6_I	22_E	1.273	1.00
80_N	89_I	1.216	1.00
41_E	44_E	1.207	1.00
26_K	30_E	1.203	1.00
37_S	40_E	1.200	1.00
74_V	77_V	1.159	1.00
30_E	34_S	1.131	1.00
9_V	29_T	1.105	0.99
38_F	42_L	1.103	0.99
84_H	88_Y	1.089	0.99
3_R	33_D	1.084	0.99
29_T	33_D	1.068	0.99
78_M	89_I	1.064	0.99
3_R	40_E	1.035	0.99
12_V	16_A	1.032	0.99
42_L	47_T	1.029	0.99
18_L	28_F	1.029	0.99
10_K	22_E	1.024	0.99
9_V	32_L	1.020	0.99
14_H	17_R	0.966	0.98
34_S	37_S	0.954	0.98
31_Q	35_I	0.954	0.98
9_V	13_A	0.934	0.98
34_S	38_F	0.931	0.98
8_E	11_H	0.878	0.97
53_T	94_I	0.874	0.97
74_V	78_M	0.865	0.97
12_V	33_D	0.836	0.96
38_F	41_E	0.831	0.96
57_L	92_P	0.830	0.96
52_P	55_H	0.823	0.96
23_E	26_K	0.797	0.95
24_E	27_M	0.770	0.94
6_I	29_T	0.769	0.94
42_L	46_N	0.766	0.94
62_V	90_R	0.756	0.94
9_V	12_V	0.742	0.93
81_A	89_I	0.733	0.92
21_T	25_A	0.725	0.92
23_E	27_M	0.714	0.91
4_I	8_E	0.704	0.91
13_A	91_V	0.703	0.91
35_I	39_A	0.698	0.91
27_M	30_E	0.686	0.90
12_V	31_Q	0.684	0.90
13_A	64_R	0.684	0.90
80_N	84_H	0.679	0.89
52_P	56_V	0.678	0.89
56_V	59_M	0.670	0.89
56_V	71_G	0.667	0.88
78_M	81_A	0.663	0.88
25_A	29_T	0.660	0.88
85_K	90_R	0.652	0.87
54_T	91_V	0.646	0.87
40_E	44_E	0.642	0.87
9_V	25_A	0.641	0.86
42_L	45_V	0.637	0.86
6_I	27_M	0.637	0.86
4_I	54_T	0.634	0.86
20_I	41_E	0.630	0.85
3_R	36_I	0.627	0.85
15_L	35_I	0.622	0.85
63_M	88_Y	0.621	0.85
11_H	14_H	0.612	0.84
92_P	95_L	0.606	0.83
48_D	51_E	0.605	0.83
9_V	94_I	0.605	0.83
28_F	32_L	0.605	0.83
36_I	93_S	0.601	0.83
21_T	26_K	0.601	0.83
39_A	88_Y	0.601	0.83
36_I	63_M	0.590	0.82
13_A	82_P	0.586	0.81
34_S	53_T	0.585	0.81
34_S	40_E	0.584	0.81
57_L	60_K	0.581	0.81
8_E	29_T	0.575	0.80
39_A	53_T	0.569	0.79
90_R	95_L	0.561	0.78
69_G	72_L	0.561	0.78
5_S	40_E	0.557	0.78
20_I	24_E	0.556	0.78
16_A	19_A	0.556	0.78
61_N	90_R	0.555	0.78
8_E	12_V	0.554	0.77
8_E	13_A	0.553	0.77
11_H	15_L	0.551	0.77
21_T	27_M	0.549	0.77
74_V	84_H	0.542	0.76
26_K	51_E	0.536	0.75
18_L	90_R	0.536	0.75
68_A	75_E	0.534	0.75
14_H	28_F	0.532	0.75
7_E	29_T	0.532	0.75
42_L	88_Y	0.531	0.74
58_K	62_V	0.530	0.74
11_H	85_K	0.530	0.74
5_S	76_D	0.530	0.74
13_A	18_L	0.530	0.74
61_N	65_E	0.527	0.74
61_N	72_L	0.527	0.74
82_P	91_V	0.525	0.74
22_E	26_K	0.524	0.73
44_E	56_V	0.517	0.72
57_L	61_N	0.513	0.72
16_A	29_T	0.507	0.71
74_V	90_R	0.503	0.70
53_T	71_G	0.501	0.70
4_I	14_H	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ip4C	1	0.9583	100	0.088	Contact Map
3al0C	1	0.9583	100	0.098	Contact Map
4wj3C	1	0.9792	100	0.126	Contact Map
3h0lC	1	0.9479	100	0.128	Contact Map
3kfuG	1	0.8958	100	0.18	Contact Map
4n0hF	1	0.8438	100	0.222	Contact Map
1pzgA	4	0.4688	15.9	0.917	Contact Map
4dmvA	1	0.8021	12.9	0.92	Contact Map
2bvlA	1	0.8646	10.1	0.924	Contact Map
4xosA	1	0.5104	8.9	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.