TATAY - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TATAY - Sec-independent protein translocase protein TatAy

UniProt:	O05522	Sequences: MPIGPGSLAVIAIVALIIFGPKKLPELGKAAGDTLREFKNATKGLTSDEEEKKKEDQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	57 (53)
Sequences:	372 (214)
Seq/√Len:	29.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_A	36_R	3.139	1.00
27_L	34_T	2.794	1.00
33_D	36_R	1.985	0.97
14_V	17_I	1.977	0.97
2_P	29_K	1.798	0.94
33_D	41_A	1.722	0.93
49_E	52_K	1.652	0.91
26_E	33_D	1.623	0.90
15_A	29_K	1.609	0.90
5_P	12_A	1.587	0.89
2_P	5_P	1.516	0.87
49_E	53_K	1.431	0.84
15_A	18_I	1.397	0.82
29_K	36_R	1.353	0.80
40_N	43_K	1.207	0.72
18_I	27_L	1.197	0.71
22_K	46_T	1.180	0.70
3_I	7_S	1.148	0.68
23_K	30_A	1.147	0.68
41_A	44_G	1.142	0.67
6_G	9_A	1.117	0.66
47_S	54_K	1.101	0.65
7_S	35_L	1.080	0.63
22_K	29_K	1.067	0.62
7_S	18_I	1.049	0.61
34_T	41_A	1.035	0.60
40_N	44_G	1.022	0.59
9_A	13_I	1.021	0.59
51_E	54_K	1.020	0.59
50_E	54_K	1.020	0.59
18_I	34_T	0.995	0.57
22_K	26_E	0.991	0.56
44_G	47_S	0.976	0.55
6_G	27_L	0.968	0.54
39_K	45_L	0.952	0.53
43_K	49_E	0.945	0.53
29_K	33_D	0.932	0.52
10_V	26_E	0.916	0.50
46_T	53_K	0.916	0.50
31_A	35_L	0.903	0.49
3_I	6_G	0.903	0.49
13_I	17_I	0.893	0.49
43_K	47_S	0.862	0.46
22_K	45_L	0.860	0.46
22_K	31_A	0.847	0.45
22_K	50_E	0.843	0.45
46_T	49_E	0.824	0.43
18_I	33_D	0.821	0.43
27_L	31_A	0.813	0.42
11_I	18_I	0.807	0.42
43_K	46_T	0.787	0.40
3_I	13_I	0.786	0.40
10_V	15_A	0.780	0.40
26_E	39_K	0.770	0.39
12_A	17_I	0.739	0.37
8_L	12_A	0.729	0.36
8_L	11_I	0.711	0.35
22_K	35_L	0.701	0.34
33_D	42_T	0.699	0.34
30_A	45_L	0.696	0.34
45_L	51_E	0.647	0.30
5_P	8_L	0.647	0.30
36_R	47_S	0.642	0.30
29_K	53_K	0.613	0.28
6_G	44_G	0.606	0.28
44_G	52_K	0.600	0.27
14_V	50_E	0.597	0.27
18_I	49_E	0.595	0.27
40_N	52_K	0.586	0.27
4_G	26_E	0.583	0.26
13_I	52_K	0.577	0.26
13_I	27_L	0.563	0.25
47_S	51_E	0.558	0.25
9_A	31_A	0.535	0.23
8_L	14_V	0.534	0.23
4_G	14_V	0.531	0.23
10_V	29_K	0.530	0.23
46_T	52_K	0.527	0.23
36_R	50_E	0.521	0.23
18_I	50_E	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l16A	1	0.8772	99.6	0.391	Contact Map
2mn6B	2	0.807	99.5	0.413	Contact Map
2mi2A	1	1	99.5	0.424	Contact Map
2lzrA	1	0.8421	99.4	0.468	Contact Map
1vsy5	1	0.9825	25.9	0.883	Contact Map
2wb0X	1	0.9298	11.4	0.9	Contact Map
4d8pB	1	0	11.3	0.9	Contact Map
3eb7A	2	0.8421	5.1	0.915	Contact Map
1wgxA	1	0.9474	4.7	0.916	Contact Map
2j69A	1	0.9123	4.1	0.919	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.