MOAC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MOAC - Cyclic pyranopterin monophosphate synthase accessory protein

UniProt:	O05520	Sequences: MNGFSHFNEQGRAQMVDISEKSSTVRTAAAVSSVHMKNEVYEKIQSHDIGKGDVLAVAQVAGIMAAKQTSNIIPMCHPLSLSGVDISFDWKIKEAEVILHIKAQVKTKGSTGVEMEALTSASVCALTVYDMCKALDKGMVIGPTFLLEKTGGKNGDFKRELSEYNLEDQK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	170 (154)
Sequences:	2921 (1745)
Seq/√Len:	140.6

ECOLI - MOAC
BACSU - MOAC
HALSA - MOAC
SULSO - MOAC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
68_Q	71_N	5.195	1.00
101_I	125_A	2.934	1.00
103_A	120_S	2.802	1.00
43_K	135_L	2.640	1.00
31_V	147_L	2.537	1.00
32_S	144_T	2.434	1.00
8_N	12_R	2.382	1.00
148_E	156_D	2.337	1.00
31_V	100_H	2.293	1.00
148_E	158_K	2.209	1.00
35_H	142_G	2.207	1.00
32_S	121_A	2.162	1.00
42_E	46_S	2.065	1.00
23_S	110_S	2.010	1.00
62_G	124_C	1.894	1.00
33_S	98_I	1.880	1.00
25_V	106_K	1.872	1.00
150_T	156_D	1.832	1.00
29_A	104_Q	1.688	1.00
31_V	145_F	1.685	1.00
72_I	123_V	1.673	1.00
33_S	100_H	1.635	1.00
27_T	104_Q	1.632	1.00
122_S	144_T	1.629	1.00
129_Y	146_L	1.605	1.00
34_V	125_A	1.592	1.00
138_G	157_F	1.575	1.00
37_K	40_V	1.550	1.00
23_S	108_K	1.538	1.00
41_Y	90_W	1.536	1.00
91_K	100_H	1.534	1.00
66_A	120_S	1.486	1.00
145_F	159_R	1.479	1.00
35_H	140_V	1.470	1.00
91_K	96_E	1.461	1.00
137_K	154_N	1.455	1.00
44_I	132_C	1.455	1.00
27_T	150_T	1.436	1.00
88_F	99_L	1.426	1.00
36_M	40_V	1.424	1.00
132_C	139_M	1.418	1.00
38_N	42_E	1.416	1.00
45_Q	90_W	1.398	1.00
33_S	143_P	1.379	1.00
90_W	99_L	1.378	1.00
32_S	125_A	1.353	1.00
80_S	109_G	1.352	1.00
27_T	106_K	1.333	1.00
31_V	102_K	1.311	1.00
53_D	56_A	1.306	1.00
81_L	105_V	1.255	1.00
62_G	86_I	1.243	1.00
72_I	119_T	1.237	1.00
56_A	59_Q	1.236	1.00
60_V	75_M	1.223	1.00
34_V	139_M	1.212	1.00
80_S	107_T	1.210	1.00
103_A	121_A	1.183	1.00
19_S	82_S	1.176	1.00
49_I	54_V	1.174	1.00
83_G	106_K	1.171	1.00
7_F	57_V	1.145	0.99
121_A	144_T	1.142	0.99
89_D	100_H	1.142	0.99
89_D	102_K	1.134	0.99
17_D	106_K	1.127	0.99
29_A	102_K	1.124	0.99
13_A	56_A	1.123	0.99
41_Y	97_V	1.123	0.99
43_K	48_D	1.122	0.99
118_L	126_L	1.122	0.99
140_V	143_P	1.102	0.99
125_A	141_I	1.097	0.99
62_G	103_A	1.086	0.99
37_K	136_D	1.083	0.99
43_K	49_I	1.080	0.99
82_S	110_S	1.070	0.99
66_A	81_L	1.064	0.99
122_S	141_I	1.039	0.99
99_L	128_V	1.038	0.99
29_A	148_E	1.037	0.99
49_I	132_C	1.002	0.98
57_V	60_V	0.995	0.98
91_K	95_A	0.994	0.98
12_R	59_Q	0.992	0.98
81_L	113_V	0.992	0.98
35_H	98_I	0.988	0.98
49_I	135_L	0.986	0.98
87_S	102_K	0.963	0.98
19_S	25_V	0.957	0.98
66_A	84_V	0.956	0.98
34_V	128_V	0.952	0.98
141_I	144_T	0.941	0.98
60_V	64_M	0.936	0.98
29_A	103_A	0.925	0.97
79_L	107_T	0.925	0.97
54_V	128_V	0.920	0.97
59_Q	87_S	0.918	0.97
147_L	159_R	0.913	0.97
27_T	148_E	0.904	0.97
38_N	97_V	0.901	0.97
23_S	109_G	0.890	0.97
36_M	41_Y	0.887	0.97
13_A	59_Q	0.878	0.96
19_S	106_K	0.876	0.96
91_K	98_I	0.873	0.96
31_V	143_P	0.869	0.96
70_S	78_P	0.868	0.96
80_S	110_S	0.844	0.96
105_V	113_V	0.841	0.95
102_K	147_L	0.837	0.95
65_A	123_V	0.830	0.95
140_V	145_F	0.825	0.95
86_I	124_C	0.819	0.95
8_N	14_Q	0.819	0.95
122_S	125_A	0.812	0.95
39_E	42_E	0.812	0.95
58_A	127_T	0.809	0.94
24_T	151_G	0.804	0.94
55_L	99_L	0.802	0.94
73_I	127_T	0.799	0.94
79_L	105_V	0.793	0.94
25_V	108_K	0.792	0.94
53_D	57_V	0.791	0.94
8_N	85_D	0.787	0.94
136_D	139_M	0.784	0.93
36_M	139_M	0.780	0.93
34_V	101_I	0.779	0.93
61_A	127_T	0.778	0.93
91_K	97_V	0.763	0.93
101_I	124_C	0.763	0.93
33_S	142_G	0.759	0.92
13_A	53_D	0.757	0.92
98_I	142_G	0.752	0.92
42_E	45_Q	0.750	0.92
137_K	153_K	0.750	0.92
20_E	25_V	0.749	0.92
44_I	54_V	0.747	0.92
84_V	105_V	0.737	0.91
41_Y	45_Q	0.734	0.91
63_I	75_M	0.730	0.91
40_V	136_D	0.729	0.91
14_Q	75_M	0.728	0.91
88_F	128_V	0.727	0.91
82_S	108_K	0.726	0.91
129_Y	132_C	0.723	0.90
88_F	101_I	0.713	0.90
7_F	50_G	0.712	0.90
14_Q	83_G	0.708	0.89
87_S	104_Q	0.701	0.89
7_F	47_H	0.688	0.88
44_I	99_L	0.684	0.88
47_H	53_D	0.682	0.88
3_G	9_E	0.674	0.87
59_Q	85_D	0.669	0.87
101_I	121_A	0.659	0.86
22_S	110_S	0.658	0.86
57_V	75_M	0.657	0.86
55_L	88_F	0.652	0.85
14_Q	85_D	0.651	0.85
129_Y	139_M	0.650	0.85
119_T	123_V	0.642	0.84
70_S	80_S	0.640	0.84
44_I	49_I	0.637	0.84
81_L	84_V	0.636	0.84
17_D	83_G	0.635	0.84
140_V	159_R	0.630	0.83
73_I	134_A	0.629	0.83
129_Y	137_K	0.620	0.82
85_D	104_Q	0.619	0.82
30_A	121_A	0.616	0.82
139_M	146_L	0.615	0.82
50_G	135_L	0.608	0.81
4_F	132_C	0.607	0.81
19_S	108_K	0.605	0.81
37_K	41_Y	0.602	0.80
18_I	110_S	0.592	0.79
10_Q	87_S	0.592	0.79
50_G	128_V	0.585	0.78
33_S	91_K	0.585	0.78
105_V	117_A	0.583	0.78
37_K	138_G	0.582	0.78
41_Y	44_I	0.581	0.78
40_V	135_L	0.580	0.78
138_G	146_L	0.580	0.78
11_G	53_D	0.578	0.78
70_S	79_L	0.578	0.78
13_A	88_F	0.574	0.77
65_A	70_S	0.573	0.77
41_Y	98_I	0.571	0.77
82_S	107_T	0.570	0.77
16_V	134_A	0.568	0.76
40_V	44_I	0.566	0.76
40_V	132_C	0.565	0.76
66_A	103_A	0.561	0.76
15_M	18_I	0.559	0.75
65_A	119_T	0.557	0.75
53_D	59_Q	0.555	0.75
47_H	56_A	0.555	0.75
7_F	56_A	0.553	0.75
33_S	96_E	0.551	0.74
150_T	158_K	0.551	0.74
54_V	109_G	0.550	0.74
64_M	69_T	0.549	0.74
137_K	150_T	0.548	0.74
86_I	103_A	0.548	0.74
119_T	126_L	0.548	0.74
45_Q	96_E	0.545	0.73
61_A	113_V	0.545	0.73
59_Q	81_L	0.545	0.73
105_V	146_L	0.545	0.73
4_F	134_A	0.541	0.73
13_A	57_V	0.540	0.73
68_Q	72_I	0.535	0.72
20_E	23_S	0.534	0.72
63_I	84_V	0.533	0.72
4_F	43_K	0.529	0.71
82_S	109_G	0.528	0.71
36_M	136_D	0.526	0.71
74_P	127_T	0.519	0.70
3_G	158_K	0.514	0.69
64_M	70_S	0.514	0.69
57_V	64_M	0.512	0.69
66_A	105_V	0.511	0.69
137_K	155_G	0.507	0.68
3_G	43_K	0.506	0.68
78_P	81_L	0.504	0.68
62_G	66_A	0.503	0.67
36_M	132_C	0.502	0.67
59_Q	88_F	0.500	0.67
20_E	108_K	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2eeyA	5	0.9412	100	0.041	Contact Map
4pyaA	3	0.7294	100	0.041	Contact Map
2iihA	4	0.8588	100	0.069	Contact Map
4fdfA	5	0.8294	100	0.085	Contact Map
2eknA	5	0.8176	100	0.105	Contact Map
2ohdA	5	0.8059	100	0.152	Contact Map
3bkrA	1	0.3941	5.9	0.967	Contact Map
1ccwB	2	0.3471	4.2	0.969	Contact Map
1at0A	2	0.4941	3	0.971	Contact Map
2ia9A	2	0.3529	3	0.971	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.