TSAB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TSAB - tRNA threonylcarbamoyladenosine biosynthesis protein TsaB

UniProt:	O05516	Sequences: MTILAIDTSNYTLGIALLREDTVIAEYITYLKKNHSVRAMPAVHSLLNDCDMAPQDLSKIVVAKGPGSYTGVRIGVTLAKTLAWSLDIPISAVSSLETLAANGRHFDGLISPIFDARRGQVYTGLYQYKNGLLEQVVPDQNVMLADWLEMLKEKDRPVLFLGHDTSLHKQMIEDVLGTKGFIGTAAQHNPRPSELAFLGKEKEAADVHGLVPDYLRLAEAEAKWIESQK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	229 (201)
Sequences:	7587 (5123)
Seq/√Len:	361.4

ECOLI - TSAB
BACSU - TSAB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_T	19_R	3.802	1.00
61_V	199_G	3.092	1.00
5_A	196_A	2.908	1.00
44_H	48_N	2.878	1.00
54_P	86_L	2.792	1.00
43_V	78_L	2.644	1.00
45_S	49_D	2.637	1.00
98_T	195_L	2.563	1.00
19_R	22_T	2.496	1.00
2_T	52_M	2.479	1.00
127_Q	132_L	2.462	1.00
27_Y	45_S	2.451	1.00
34_N	37_V	2.427	1.00
27_Y	49_D	2.361	1.00
39_A	78_L	2.236	1.00
62_V	76_V	2.227	1.00
57_L	88_I	2.084	1.00
60_I	79_A	2.077	1.00
77_T	81_T	2.075	1.00
106_F	184_T	2.059	1.00
53_A	56_D	2.056	1.00
58_S	88_I	2.052	1.00
3_I	59_K	2.045	1.00
83_A	90_I	2.030	1.00
62_V	90_I	2.017	1.00
54_P	57_L	2.011	1.00
60_I	82_L	2.004	1.00
59_K	91_S	1.986	1.00
9_S	63_A	1.979	1.00
17_L	46_L	1.934	1.00
79_A	90_I	1.929	1.00
127_Q	134_E	1.917	1.00
125_L	156_R	1.868	1.00
81_T	85_S	1.866	1.00
47_L	54_P	1.835	1.00
25_A	46_L	1.805	1.00
15_I	43_V	1.688	1.00
158_V	179_K	1.637	1.00
173_E	177_G	1.616	1.00
135_Q	138_P	1.607	1.00
60_I	88_I	1.588	1.00
2_T	58_S	1.586	1.00
46_L	50_C	1.535	1.00
40_M	78_L	1.530	1.00
64_K	92_A	1.480	1.00
29_T	38_R	1.413	1.00
16_A	192_P	1.413	1.00
26_E	191_R	1.406	1.00
97_E	133_L	1.397	1.00
3_I	61_V	1.384	1.00
23_V	26_E	1.370	1.00
96_L	115_D	1.365	1.00
17_L	50_C	1.326	1.00
15_I	42_A	1.305	1.00
170_Q	173_E	1.298	1.00
57_L	86_L	1.297	1.00
172_I	175_V	1.296	1.00
124_G	135_Q	1.293	1.00
43_V	82_L	1.249	1.00
171_M	174_D	1.247	1.00
171_M	175_V	1.237	1.00
146_D	149_E	1.237	1.00
176_L	180_G	1.232	1.00
143_M	146_D	1.222	1.00
82_L	86_L	1.221	1.00
52_M	56_D	1.220	1.00
18_L	196_A	1.220	1.00
111_S	126_Y	1.220	1.00
6_I	75_G	1.219	1.00
14_G	192_P	1.194	1.00
17_L	52_M	1.183	1.00
8_T	75_G	1.164	1.00
26_E	30_Y	1.158	1.00
15_I	46_L	1.157	1.00
142_V	147_W	1.154	1.00
194_E	198_L	1.135	1.00
6_I	43_V	1.133	1.00
13_L	42_A	1.129	1.00
94_S	139_D	1.120	1.00
27_Y	42_A	1.111	1.00
125_L	134_E	1.109	1.00
94_S	97_E	1.104	1.00
191_R	194_E	1.102	1.00
17_L	57_L	1.094	1.00
125_L	154_K	1.086	1.00
5_A	199_G	1.074	1.00
165_T	168_H	1.058	1.00
189_N	192_P	1.048	1.00
7_D	63_A	1.044	1.00
190_P	194_E	1.041	1.00
45_S	48_N	1.036	1.00
54_P	82_L	1.029	1.00
127_Q	156_R	1.025	1.00
47_L	52_M	1.024	1.00
72_V	76_V	1.022	1.00
25_A	50_C	1.021	1.00
184_T	187_Q	1.016	1.00
34_N	38_R	1.010	1.00
170_Q	174_D	1.009	1.00
137_V	150_M	1.009	1.00
108_G	157_P	1.008	1.00
81_T	84_W	1.004	1.00
60_I	86_L	0.993	1.00
169_K	173_E	0.991	1.00
55_Q	86_L	0.991	1.00
128_Y	133_L	0.977	1.00
59_K	89_P	0.974	1.00
130_N	133_L	0.970	1.00
19_R	24_I	0.968	1.00
6_I	79_A	0.963	1.00
25_A	29_T	0.963	1.00
135_Q	139_D	0.958	1.00
26_E	193_S	0.949	1.00
164_D	168_H	0.949	1.00
111_S	125_L	0.942	1.00
192_P	195_L	0.935	1.00
109_L	125_L	0.927	1.00
158_V	162_G	0.925	1.00
137_V	140_Q	0.920	1.00
99_L	161_L	0.909	1.00
101_A	104_R	0.909	1.00
62_V	75_G	0.908	1.00
5_A	61_V	0.904	1.00
73_R	77_T	0.899	1.00
128_Y	132_L	0.895	1.00
11_Y	163_H	0.895	1.00
14_G	28_I	0.894	1.00
120_Q	141_N	0.894	1.00
192_P	199_G	0.886	1.00
10_N	114_F	0.886	1.00
60_I	83_A	0.883	1.00
93_V	98_T	0.881	1.00
12_T	30_Y	0.876	1.00
109_L	127_Q	0.873	1.00
120_Q	143_M	0.869	1.00
111_S	160_F	0.868	1.00
122_Y	138_P	0.867	1.00
123_T	142_V	0.863	1.00
5_A	192_P	0.859	1.00
78_L	81_T	0.859	1.00
146_D	150_M	0.852	1.00
140_Q	150_M	0.851	1.00
27_Y	46_L	0.845	1.00
98_T	198_L	0.839	1.00
65_G	94_S	0.834	1.00
129_K	134_E	0.831	1.00
38_R	41_P	0.827	1.00
18_L	197_F	0.824	1.00
69_Y	73_R	0.821	1.00
194_E	199_G	0.811	1.00
2_T	56_D	0.808	1.00
174_D	178_T	0.807	1.00
196_A	199_G	0.806	1.00
200_K	203_E	0.793	1.00
123_T	147_W	0.790	1.00
113_I	162_G	0.788	1.00
76_V	80_K	0.783	1.00
63_A	95_S	0.780	1.00
145_A	149_E	0.769	1.00
164_D	167_L	0.767	1.00
110_I	161_L	0.764	1.00
172_I	180_G	0.763	1.00
27_Y	30_Y	0.762	1.00
108_G	159_L	0.760	1.00
100_A	113_I	0.754	1.00
175_V	178_T	0.749	1.00
101_A	197_F	0.746	1.00
189_N	198_L	0.739	1.00
109_L	129_K	0.737	1.00
80_K	90_I	0.734	1.00
48_N	51_D	0.733	1.00
9_S	95_S	0.733	1.00
40_M	44_H	0.726	1.00
192_P	198_L	0.726	1.00
26_E	29_T	0.725	1.00
174_D	177_G	0.724	1.00
158_V	181_F	0.721	1.00
5_A	18_L	0.721	1.00
103_G	162_G	0.720	0.99
112_P	123_T	0.719	0.99
97_E	135_Q	0.718	0.99
173_E	176_L	0.716	0.99
26_E	46_L	0.715	0.99
17_L	47_L	0.714	0.99
190_P	195_L	0.712	0.99
2_T	17_L	0.712	0.99
96_L	124_G	0.710	0.99
190_P	199_G	0.706	0.99
47_L	86_L	0.701	0.99
10_N	63_A	0.701	0.99
52_M	57_L	0.699	0.99
12_T	28_I	0.698	0.99
59_K	199_G	0.686	0.99
70_T	73_R	0.684	0.99
2_T	57_L	0.683	0.99
116_A	122_Y	0.683	0.99
47_L	57_L	0.675	0.99
115_D	122_Y	0.674	0.99
157_P	179_K	0.672	0.99
19_R	52_M	0.671	0.99
167_L	185_A	0.666	0.99
141_N	145_A	0.666	0.99
101_A	133_L	0.665	0.99
47_L	50_C	0.664	0.99
195_L	199_G	0.661	0.99
136_V	139_D	0.660	0.99
119_G	143_M	0.658	0.99
141_N	144_L	0.657	0.99
119_G	171_M	0.655	0.99
99_L	112_P	0.653	0.99
172_I	176_L	0.653	0.99
2_T	5_A	0.648	0.99
61_V	195_L	0.648	0.99
36_S	70_T	0.647	0.99
78_L	82_L	0.646	0.99
190_P	198_L	0.646	0.99
10_N	95_S	0.636	0.99
141_N	149_E	0.635	0.99
97_E	126_Y	0.632	0.99
108_G	158_V	0.632	0.99
39_A	43_V	0.630	0.99
35_H	75_G	0.629	0.99
25_A	30_Y	0.628	0.99
194_E	197_F	0.626	0.99
77_T	80_K	0.624	0.99
61_V	196_A	0.624	0.99
190_P	193_S	0.622	0.99
124_G	133_L	0.618	0.98
193_S	196_A	0.617	0.98
20_E	58_S	0.615	0.98
148_L	152_K	0.613	0.98
103_G	161_L	0.612	0.98
76_V	92_A	0.611	0.98
93_V	195_L	0.608	0.98
109_L	112_P	0.605	0.98
97_E	101_A	0.602	0.98
4_L	60_I	0.599	0.98
109_L	136_V	0.599	0.98
112_P	161_L	0.596	0.98
59_K	92_A	0.596	0.98
25_A	28_I	0.595	0.98
75_G	79_A	0.595	0.98
148_L	172_I	0.595	0.98
13_L	38_R	0.592	0.98
62_V	79_A	0.590	0.98
93_V	198_L	0.590	0.98
101_A	198_L	0.589	0.98
136_V	154_K	0.587	0.98
102_N	194_E	0.584	0.98
24_I	27_Y	0.581	0.98
64_K	76_V	0.581	0.98
20_E	200_K	0.580	0.98
32_K	70_T	0.578	0.98
81_T	86_L	0.578	0.98
112_P	154_K	0.577	0.98
57_L	60_I	0.576	0.98
91_S	199_G	0.575	0.98
145_A	171_M	0.575	0.98
69_Y	77_T	0.573	0.98
99_L	114_F	0.573	0.98
115_D	120_Q	0.566	0.97
187_Q	190_P	0.564	0.97
154_K	158_V	0.559	0.97
148_L	151_L	0.558	0.97
97_E	124_G	0.553	0.97
142_V	150_M	0.551	0.97
109_L	158_V	0.550	0.97
97_E	100_A	0.550	0.97
113_I	121_V	0.550	0.97
61_V	91_S	0.549	0.97
41_P	44_H	0.549	0.97
108_G	181_F	0.544	0.97
7_D	14_G	0.542	0.97
161_L	182_I	0.539	0.96
115_D	167_L	0.537	0.96
13_L	39_A	0.537	0.96
189_N	195_L	0.537	0.96
18_L	23_V	0.534	0.96
35_H	68_S	0.530	0.96
23_V	27_Y	0.528	0.96
5_A	16_A	0.527	0.96
166_S	169_K	0.526	0.96
166_S	184_T	0.522	0.96
71_G	100_A	0.522	0.96
9_S	72_V	0.522	0.96
155_D	158_V	0.520	0.96
110_I	133_L	0.520	0.96
160_F	165_T	0.516	0.95
96_L	112_P	0.515	0.95
18_L	21_D	0.514	0.95
100_A	124_G	0.514	0.95
10_N	190_P	0.512	0.95
187_Q	192_P	0.510	0.95
113_I	160_F	0.508	0.95
103_G	160_F	0.507	0.95
62_V	80_K	0.505	0.95
25_A	49_D	0.504	0.95
121_V	147_W	0.502	0.95
101_A	129_K	0.501	0.95
124_G	139_D	0.501	0.95
68_S	80_K	0.501	0.95
139_D	143_M	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zeuA	1	0.9694	100	0.234	Contact Map
2a6aA	3	0.8428	100	0.241	Contact Map
5br9A	2	0.9127	100	0.267	Contact Map
3r6mA	2	0.8952	100	0.303	Contact Map
3en9A	1	0.952	100	0.534	Contact Map
3venA	1	0.9694	99.9	0.597	Contact Map
4k25A	2	0.9083	99.9	0.599	Contact Map
3enoA	1	0.9651	99.9	0.611	Contact Map
2ivnA	1	0.9782	99.9	0.611	Contact Map
3zeuB	1	0.9083	99.9	0.62	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.