PTEB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTEB - Oligo-beta-mannoside-specific phosphotransferase enzyme IIB component

UniProt:	O05505	Sequences: MKKILLACSSGMSTSLLVTKMKEYAQSIGEEAEIWAVGQDKAKEDMRKADAVLIGPQMSFLKSELQKEADQYNIQVEVIDMMAYGMADGKKAYEQALSLMVNQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	103 (97)
Sequences:	1217 (873)
Seq/√Len:	88.6

ECOLI - PTQB
BACSU - PTEB PTJB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_K	66_Q	3.480	1.00
28_I	94_E	3.449	1.00
3_K	33_E	2.356	1.00
80_D	95_Q	2.326	1.00
51_A	99_L	2.042	1.00
83_A	88_D	2.010	1.00
90_K	94_E	2.006	1.00
42_A	65_L	2.000	1.00
19_T	22_K	1.978	1.00
43_K	68_E	1.940	1.00
17_L	92_A	1.851	1.00
19_T	23_E	1.812	1.00
77_E	99_L	1.804	1.00
80_D	83_A	1.787	1.00
18_V	34_I	1.757	1.00
83_A	91_K	1.697	1.00
30_E	97_L	1.681	1.00
66_Q	70_D	1.623	1.00
5_L	49_A	1.614	1.00
5_L	37_V	1.534	1.00
24_Y	28_I	1.497	1.00
28_I	90_K	1.479	1.00
23_E	27_S	1.463	0.99
63_S	66_Q	1.451	0.99
21_M	34_I	1.436	0.99
95_Q	98_S	1.420	0.99
23_E	26_Q	1.373	0.99
24_Y	27_S	1.320	0.99
32_A	97_L	1.320	0.99
16_L	19_T	1.272	0.98
94_E	98_S	1.266	0.98
88_D	91_K	1.238	0.98
61_L	64_E	1.228	0.98
53_L	77_E	1.225	0.98
12_M	15_S	1.212	0.98
24_Y	90_K	1.183	0.98
24_Y	89_G	1.176	0.97
7_A	42_A	1.151	0.97
16_L	87_A	1.147	0.97
67_K	70_D	1.140	0.97
83_A	92_A	1.128	0.97
25_A	34_I	1.124	0.97
77_E	95_Q	1.122	0.97
22_K	26_Q	1.111	0.96
91_K	94_E	1.111	0.96
83_A	95_Q	1.102	0.96
39_Q	61_L	1.070	0.96
46_M	69_A	1.070	0.96
6_L	14_T	1.057	0.95
65_L	76_V	1.022	0.94
70_D	73_N	1.014	0.94
64_E	67_K	1.012	0.94
35_W	49_A	1.004	0.94
5_L	35_W	1.002	0.94
28_I	97_L	1.001	0.94
93_Y	97_L	0.981	0.93
17_L	79_I	0.968	0.93
62_K	77_E	0.964	0.92
4_I	32_A	0.962	0.92
27_S	90_K	0.962	0.92
30_E	93_Y	0.956	0.92
69_A	72_Y	0.949	0.92
51_A	100_M	0.943	0.92
52_V	74_I	0.942	0.91
25_A	32_A	0.940	0.91
10_S	38_G	0.937	0.91
54_I	58_M	0.930	0.91
62_K	76_V	0.927	0.91
65_L	69_A	0.924	0.91
21_M	96_A	0.921	0.91
42_A	49_A	0.915	0.90
4_I	96_A	0.915	0.90
7_A	37_V	0.913	0.90
22_K	33_E	0.913	0.90
52_V	69_A	0.884	0.89
24_Y	93_Y	0.874	0.88
14_T	55_G	0.848	0.87
62_K	78_V	0.845	0.86
47_R	72_Y	0.825	0.85
51_A	96_A	0.809	0.84
52_V	65_L	0.807	0.84
3_K	49_A	0.769	0.81
3_K	35_W	0.768	0.81
37_V	49_A	0.765	0.80
54_I	78_V	0.764	0.80
35_W	45_D	0.754	0.79
86_M	91_K	0.754	0.79
96_A	99_L	0.753	0.79
7_A	52_V	0.743	0.78
54_I	62_K	0.740	0.78
20_K	23_E	0.732	0.77
45_D	48_K	0.727	0.77
25_A	93_Y	0.704	0.75
79_I	92_A	0.686	0.73
89_G	92_A	0.674	0.71
39_Q	65_L	0.668	0.71
19_T	26_Q	0.668	0.71
41_K	44_E	0.667	0.71
42_A	52_V	0.658	0.70
8_C	11_G	0.652	0.69
53_L	95_Q	0.647	0.68
95_Q	99_L	0.642	0.68
13_S	84_Y	0.640	0.67
40_D	61_L	0.637	0.67
94_E	97_L	0.624	0.65
69_A	73_N	0.609	0.64
58_M	61_L	0.606	0.63
63_S	67_K	0.598	0.62
9_S	38_G	0.592	0.61
12_M	16_L	0.592	0.61
37_V	45_D	0.590	0.61
82_M	88_D	0.588	0.61
18_V	21_M	0.585	0.60
9_S	39_Q	0.584	0.60
7_A	41_K	0.581	0.60
16_L	20_K	0.580	0.60
26_Q	31_E	0.578	0.60
87_A	92_A	0.577	0.59
5_L	69_A	0.577	0.59
40_D	58_M	0.576	0.59
6_L	21_M	0.570	0.59
14_T	21_M	0.569	0.58
55_G	76_V	0.567	0.58
82_M	86_M	0.563	0.58
13_S	85_G	0.559	0.57
33_E	48_K	0.558	0.57
7_A	58_M	0.556	0.57
21_M	92_A	0.555	0.57
30_E	100_M	0.543	0.55
39_Q	45_D	0.539	0.54
70_D	76_V	0.539	0.54
37_V	41_K	0.538	0.54
39_Q	58_M	0.535	0.54
46_M	70_D	0.533	0.54
8_C	36_A	0.531	0.53
5_L	52_V	0.529	0.53
46_M	68_E	0.529	0.53
9_S	57_Q	0.529	0.53
77_E	80_D	0.519	0.52
25_A	30_E	0.513	0.51
7_A	65_L	0.510	0.50
8_C	14_T	0.509	0.50
21_M	93_Y	0.509	0.50
9_S	61_L	0.503	0.49
32_A	60_F	0.502	0.49
9_S	58_M	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nbmA	1	0.9515	100	0.294	Contact Map
4mgeA	3	0.9903	99.9	0.34	Contact Map
1e2bA	1	0.9806	99.9	0.361	Contact Map
2l2qA	1	1	99.9	0.365	Contact Map
2kyrA	1	0.932	99.9	0.403	Contact Map
4tn5A	2	0.932	99.9	0.414	Contact Map
2m1zA	1	0.932	99.9	0.425	Contact Map
2r4qA	1	0.9126	99.9	0.444	Contact Map
1tvmA	1	0.8932	99.7	0.557	Contact Map
3czcA	1	0.8835	99.4	0.625	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.