YDHI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YDHI - Uncharacterized protein YdhI

UniProt:	O05501	Sequences: MMIIIPNNEIAKHMLTDFFAKHWGTPEMAISSGIFRCDELDGFAAVNESGEIIGCITYTIDGKDCEIISLDSMIENKGIGTALLQQVEEKAKHAHCQRIKLITTNDNVNAIAFYQKRGYQFAAVFPNAVEKARRLKPEIPEVAENGILIRDEILFSKVID	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (152)
Sequences:	178 (154)
Seq/√Len:	12.5

BACSU - YDHI YXBD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_I	155_F	5.625	1.00
65_C	96_C	4.769	1.00
104_T	129_V	4.142	1.00
131_K	134_R	4.090	1.00
127_N	130_E	4.024	1.00
88_E	157_K	3.360	0.98
120_Q	151_D	3.246	0.98
88_E	119_Y	2.755	0.94
54_G	80_G	2.621	0.92
57_T	71_D	2.552	0.91
31_S	125_F	2.234	0.84
119_Y	157_K	2.226	0.84
56_I	87_V	2.184	0.82
28_M	69_S	2.161	0.82
40_L	68_I	2.147	0.81
125_F	154_L	2.137	0.81
98_R	156_S	1.863	0.71
18_F	22_H	1.731	0.65
30_I	68_I	1.655	0.61
87_V	91_A	1.609	0.59
37_C	69_S	1.605	0.59
121_F	155_F	1.604	0.59
19_F	37_C	1.595	0.58
7_N	12_K	1.567	0.57
31_S	102_I	1.548	0.56
53_I	144_E	1.491	0.53
84_L	92_K	1.428	0.50
25_T	104_T	1.419	0.49
129_V	132_A	1.380	0.47
112_A	143_A	1.359	0.46
36_R	39_E	1.354	0.46
25_T	55_C	1.334	0.45
67_I	119_Y	1.329	0.45
121_F	148_L	1.327	0.45
23_W	106_D	1.320	0.44
13_H	17_D	1.312	0.44
72_S	75_E	1.283	0.42
121_F	153_I	1.277	0.42
56_I	67_I	1.277	0.42
50_G	61_D	1.276	0.42
43_F	56_I	1.224	0.39
41_D	68_I	1.222	0.39
33_G	68_I	1.221	0.39
111_I	121_F	1.204	0.38
55_C	71_D	1.198	0.38
98_R	123_A	1.190	0.38
31_S	129_V	1.187	0.38
30_I	35_F	1.149	0.36
81_T	117_R	1.146	0.36
19_F	157_K	1.145	0.36
5_I	11_A	1.145	0.36
69_S	75_E	1.131	0.35
87_V	99_I	1.112	0.34
33_G	157_K	1.109	0.34
60_I	65_C	1.108	0.34
108_V	145_N	1.071	0.32
19_F	88_E	1.056	0.32
88_E	151_D	1.055	0.32
96_C	101_L	1.053	0.31
46_V	97_Q	1.019	0.30
92_K	99_I	1.018	0.30
121_F	124_V	1.014	0.30
120_Q	150_R	1.013	0.30
62_G	94_A	1.010	0.30
109_N	145_N	1.004	0.29
7_N	42_G	0.997	0.29
108_V	122_A	0.968	0.28
39_E	63_K	0.967	0.28
45_A	98_R	0.961	0.28
43_F	72_S	0.958	0.27
33_G	37_C	0.956	0.27
143_A	149_I	0.941	0.27
28_M	37_C	0.939	0.27
5_I	19_F	0.937	0.27
43_F	84_L	0.935	0.27
38_D	153_I	0.933	0.26
15_L	124_V	0.930	0.26
57_T	69_S	0.927	0.26
15_L	25_T	0.919	0.26
76_N	109_N	0.919	0.26
102_I	125_F	0.917	0.26
33_G	88_E	0.913	0.26
11_A	86_Q	0.909	0.25
127_N	150_R	0.908	0.25
5_I	9_E	0.902	0.25
75_E	145_N	0.902	0.25
32_S	68_I	0.902	0.25
60_I	64_D	0.899	0.25
91_A	96_C	0.893	0.25
36_R	41_D	0.893	0.25
37_C	151_D	0.892	0.25
64_D	100_K	0.886	0.25
50_G	63_K	0.883	0.24
55_C	104_T	0.882	0.24
9_E	62_G	0.879	0.24
29_A	34_I	0.871	0.24
74_I	77_K	0.869	0.24
25_T	129_V	0.862	0.24
116_K	127_N	0.858	0.24
63_K	96_C	0.854	0.23
67_I	127_N	0.854	0.23
104_T	124_V	0.853	0.23
50_G	93_H	0.849	0.23
26_P	36_R	0.846	0.23
18_F	37_C	0.827	0.22
60_I	96_C	0.819	0.22
121_F	126_P	0.815	0.22
43_F	71_D	0.814	0.22
151_D	157_K	0.812	0.22
31_S	68_I	0.811	0.22
112_A	145_N	0.801	0.22
77_K	116_K	0.800	0.21
62_G	97_Q	0.800	0.21
42_G	67_I	0.791	0.21
27_E	72_S	0.786	0.21
132_A	157_K	0.785	0.21
83_L	152_E	0.785	0.21
63_K	81_T	0.776	0.21
12_K	32_S	0.774	0.21
12_K	149_I	0.774	0.21
17_D	49_S	0.774	0.21
33_G	119_Y	0.773	0.21
56_I	79_I	0.769	0.20
35_F	88_E	0.767	0.20
31_S	35_F	0.764	0.20
87_V	96_C	0.763	0.20
81_T	109_N	0.760	0.20
37_C	41_D	0.757	0.20
48_E	72_S	0.753	0.20
80_G	103_T	0.749	0.20
27_E	34_I	0.747	0.20
116_K	135_L	0.742	0.20
109_N	156_S	0.737	0.19
48_E	51_E	0.732	0.19
53_I	68_I	0.715	0.19
86_Q	95_H	0.714	0.19
37_C	73_M	0.713	0.19
129_V	149_I	0.712	0.19
76_N	155_F	0.710	0.19
22_H	127_N	0.705	0.18
31_S	37_C	0.705	0.18
58_Y	89_E	0.701	0.18
50_G	122_A	0.699	0.18
58_Y	90_K	0.698	0.18
66_E	103_T	0.690	0.18
99_I	121_F	0.688	0.18
92_K	124_V	0.687	0.18
91_A	143_A	0.681	0.18
81_T	90_K	0.681	0.18
22_H	73_M	0.673	0.17
93_H	99_I	0.671	0.17
60_I	101_L	0.671	0.17
126_P	156_S	0.670	0.17
108_V	121_F	0.668	0.17
62_G	95_H	0.664	0.17
31_S	151_D	0.662	0.17
77_K	97_Q	0.654	0.17
75_E	109_N	0.654	0.17
95_H	142_V	0.650	0.17
86_Q	143_A	0.648	0.17
90_K	119_Y	0.644	0.17
45_A	80_G	0.640	0.16
18_F	84_L	0.635	0.16
19_F	55_C	0.633	0.16
62_G	89_E	0.629	0.16
58_Y	136_K	0.626	0.16
42_G	138_E	0.626	0.16
148_L	156_S	0.624	0.16
35_F	68_I	0.623	0.16
59_T	109_N	0.622	0.16
61_D	67_I	0.622	0.16
125_F	153_I	0.618	0.16
65_C	87_V	0.615	0.16
87_V	155_F	0.611	0.16
21_K	138_E	0.611	0.16
42_G	72_S	0.610	0.16
19_F	32_S	0.609	0.16
82_A	138_E	0.608	0.16
68_I	100_K	0.604	0.15
15_L	36_R	0.601	0.15
32_S	35_F	0.597	0.15
120_Q	130_E	0.597	0.15
5_I	10_I	0.587	0.15
94_A	108_V	0.586	0.15
30_I	55_C	0.585	0.15
15_L	149_I	0.585	0.15
22_H	71_D	0.580	0.15
56_I	130_E	0.580	0.15
108_V	148_L	0.572	0.15
69_S	119_Y	0.568	0.15
121_F	143_A	0.565	0.14
145_N	157_K	0.564	0.14
74_I	97_Q	0.563	0.14
69_S	141_E	0.560	0.14
50_G	90_K	0.559	0.14
35_F	100_K	0.559	0.14
80_G	101_L	0.555	0.14
35_F	157_K	0.554	0.14
58_Y	132_A	0.552	0.14
34_I	91_A	0.545	0.14
22_H	150_R	0.542	0.14
38_D	61_D	0.540	0.14
112_A	147_I	0.539	0.14
132_A	136_K	0.538	0.14
34_I	73_M	0.533	0.14
19_F	31_S	0.532	0.14
54_G	103_T	0.531	0.14
89_E	142_V	0.531	0.14
13_H	21_K	0.530	0.14
50_G	135_L	0.530	0.14
7_N	124_V	0.529	0.14
24_G	155_F	0.529	0.14
42_G	117_R	0.528	0.14
112_A	144_E	0.528	0.14
89_E	92_K	0.527	0.14
17_D	142_V	0.526	0.13
61_D	68_I	0.523	0.13
26_P	38_D	0.522	0.13
59_T	146_G	0.522	0.13
32_S	37_C	0.514	0.13
106_D	116_K	0.514	0.13
45_A	96_C	0.510	0.13
51_E	130_E	0.510	0.13
125_F	150_R	0.508	0.13
103_T	152_E	0.505	0.13
112_A	117_R	0.504	0.13
122_A	128_A	0.503	0.13
64_D	72_S	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y9kA	1	0.925	99.6	0.767	Contact Map
3dr6A	2	0.9062	99.6	0.772	Contact Map
2cntA	1	0.8938	99.6	0.775	Contact Map
4luaA	1	0.8875	99.6	0.775	Contact Map
2j8mA	2	0.9125	99.6	0.776	Contact Map
1s3zA	2	0.8187	99.6	0.778	Contact Map
3zj0A	1	0.8438	99.6	0.778	Contact Map
3g8wA	2	0.8938	99.5	0.779	Contact Map
1n71A	4	0.875	99.5	0.781	Contact Map
2oh1A	1	0.8625	99.5	0.781	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.