YRHK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YRHK - Uncharacterized protein YrhK

UniProt:	O05401	Sequences: MKGNEEHDIQKELKRYELFFKKRYKVLYTVNDFIIGAMFLVGSFFFFYDRLMSAGIWLFAIGSLLLLIRPTIRLIHDFHYRKHVEQQFKHQSSTDD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	96 (81)
Sequences:	206 (167)
Seq/√Len:	18.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_L	60_A	6.024	1.00
45_F	51_L	5.533	1.00
47_F	60_A	5.400	1.00
36_G	66_L	3.474	1.00
33_F	71_T	3.095	0.99
24_Y	79_H	1.964	0.88
49_D	56_I	1.834	0.84
52_M	56_I	1.814	0.84
25_K	76_H	1.775	0.82
40_L	64_L	1.578	0.74
44_F	48_Y	1.524	0.71
48_Y	51_L	1.522	0.71
49_D	52_M	1.417	0.65
19_F	23_R	1.398	0.64
61_I	66_L	1.392	0.64
77_D	80_Y	1.304	0.59
38_M	68_I	1.279	0.57
55_G	66_L	1.267	0.57
51_L	64_L	1.263	0.56
29_T	77_D	1.260	0.56
45_F	58_L	1.224	0.54
47_F	57_W	1.213	0.53
52_M	55_G	1.207	0.53
10_Q	65_L	1.205	0.53
51_L	56_I	1.201	0.52
22_K	26_V	1.183	0.51
41_V	83_H	1.171	0.51
38_M	65_L	1.164	0.50
67_L	80_Y	1.143	0.49
21_K	29_T	1.071	0.44
20_F	67_L	1.067	0.44
37_A	53_S	1.036	0.42
29_T	73_R	1.028	0.42
49_D	72_I	1.004	0.40
26_V	74_L	0.970	0.38
20_F	82_K	0.949	0.37
54_A	82_K	0.942	0.37
27_L	30_V	0.941	0.37
79_H	83_H	0.940	0.37
11_K	71_T	0.922	0.35
58_L	65_L	0.907	0.35
33_F	66_L	0.899	0.34
30_V	37_A	0.879	0.33
68_I	71_T	0.864	0.32
76_H	84_V	0.862	0.32
47_F	76_H	0.852	0.32
13_L	37_A	0.851	0.32
51_L	55_G	0.834	0.31
24_Y	72_I	0.833	0.31
43_S	46_F	0.831	0.30
21_K	38_M	0.816	0.30
9_I	22_K	0.803	0.29
25_K	77_D	0.800	0.29
14_K	61_I	0.799	0.29
16_Y	83_H	0.796	0.29
31_N	65_L	0.787	0.28
60_A	64_L	0.785	0.28
18_L	31_N	0.772	0.27
22_K	77_D	0.771	0.27
8_D	11_K	0.769	0.27
57_W	74_L	0.758	0.27
28_Y	77_D	0.753	0.26
83_H	87_Q	0.751	0.26
31_N	35_I	0.730	0.25
15_R	71_T	0.730	0.25
24_Y	58_L	0.717	0.25
34_I	38_M	0.712	0.25
10_Q	21_K	0.697	0.24
45_F	54_A	0.687	0.23
35_I	65_L	0.687	0.23
13_L	18_L	0.685	0.23
75_I	78_F	0.685	0.23
53_S	87_Q	0.682	0.23
58_L	61_I	0.680	0.23
11_K	40_L	0.678	0.23
28_Y	69_R	0.668	0.23
41_V	58_L	0.649	0.22
47_F	66_L	0.647	0.22
14_K	74_L	0.646	0.22
10_Q	50_R	0.646	0.22
75_I	86_Q	0.643	0.21
9_I	61_I	0.641	0.21
14_K	18_L	0.639	0.21
17_E	23_R	0.636	0.21
54_A	72_I	0.635	0.21
7_H	33_F	0.627	0.21
11_K	30_V	0.621	0.21
7_H	30_V	0.616	0.20
22_K	36_G	0.612	0.20
44_F	75_I	0.610	0.20
45_F	77_D	0.605	0.20
68_I	79_H	0.599	0.20
31_N	38_M	0.598	0.20
16_Y	75_I	0.597	0.20
35_I	81_R	0.589	0.19
78_F	81_R	0.589	0.19
64_L	87_Q	0.584	0.19
24_Y	40_L	0.583	0.19
14_K	28_Y	0.573	0.19
57_W	79_H	0.572	0.19
31_N	69_R	0.564	0.18
36_G	83_H	0.562	0.18
25_K	85_E	0.557	0.18
20_F	58_L	0.553	0.18
21_K	28_Y	0.550	0.18
46_F	59_F	0.549	0.18
34_I	50_R	0.549	0.18
68_I	82_K	0.545	0.18
26_V	51_L	0.544	0.18
36_G	60_A	0.542	0.18
48_Y	53_S	0.536	0.17
31_N	67_L	0.532	0.17
27_L	61_I	0.531	0.17
7_H	50_R	0.525	0.17
37_A	78_F	0.522	0.17
20_F	77_D	0.521	0.17
26_V	48_Y	0.516	0.17
26_V	77_D	0.516	0.17
23_R	35_I	0.512	0.16
16_Y	64_L	0.507	0.16
51_L	54_A	0.504	0.16
38_M	74_L	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bjuA	1	0.0417	13.8	0.929	Contact Map
3jsrA	1	0.4062	7	0.938	Contact Map
2kzkA	1	0.6458	4.9	0.943	Contact Map
4i3mA	2	0.3229	4.7	0.943	Contact Map
4i5sA	2	0.4062	4	0.945	Contact Map
2xq2A	2	0.7604	3.9	0.945	Contact Map
4bixA	2	0	3.5	0.946	Contact Map
2kzbA	1	0.6979	3.5	0.947	Contact Map
4ry2A	2	0.8958	3.4	0.947	Contact Map
4q4hA	1	0.9688	3.3	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.