RHAM - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RHAM - L-rhamnose mutarotase

UniProt:	O05263	Sequences: MKRKASIMFVHQDKYEEYKQRHDDIWPEMAEALKAHGAHHYSIFLDEETGRLFAYLEIEDEEKWRKMADTEVCQRWWKSMAPLMKTNSDFSPVAIDLKEVFYLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	104 (101)
Sequences:	855 (565)
Seq/√Len:	56.2

ECOLI - RHAM
BACSU - RHAM

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_H	57_E	3.682	1.00
72_V	75_R	2.751	1.00
31_E	35_A	2.506	1.00
5_A	53_F	2.408	1.00
19_K	23_D	2.399	1.00
40_H	55_Y	2.344	1.00
25_I	30_A	2.341	1.00
3_R	99_E	2.254	1.00
87_N	91_S	2.020	1.00
9_F	85_K	1.994	1.00
10_V	15_Y	1.901	1.00
7_I	51_R	1.870	1.00
31_E	34_K	1.850	0.99
28_E	72_V	1.775	0.99
15_Y	50_G	1.723	0.99
6_S	54_A	1.683	0.99
21_R	83_L	1.662	0.99
17_E	20_Q	1.650	0.99
42_S	55_Y	1.594	0.98
3_R	42_S	1.547	0.98
39_H	59_E	1.537	0.98
11_H	85_K	1.504	0.98
70_T	73_C	1.494	0.98
15_Y	47_E	1.476	0.97
58_I	64_W	1.464	0.97
74_Q	78_K	1.441	0.97
40_H	102_Y	1.434	0.97
20_Q	24_D	1.426	0.97
7_I	46_D	1.393	0.96
99_E	102_Y	1.373	0.96
42_S	102_Y	1.368	0.96
26_W	72_V	1.326	0.95
47_E	98_K	1.273	0.94
36_H	67_M	1.258	0.93
3_R	102_Y	1.242	0.93
3_R	57_E	1.241	0.93
36_H	66_K	1.235	0.93
46_D	49_T	1.226	0.93
9_F	51_R	1.223	0.93
33_L	38_A	1.220	0.92
34_K	39_H	1.216	0.92
17_E	21_R	1.210	0.92
11_H	14_K	1.167	0.91
73_C	77_W	1.161	0.90
21_R	80_M	1.150	0.90
32_A	67_M	1.133	0.89
21_R	79_S	1.113	0.88
19_K	98_K	1.104	0.88
66_K	69_D	1.094	0.88
52_L	100_V	1.068	0.86
78_K	90_F	1.065	0.86
47_E	50_G	1.046	0.85
7_I	49_T	1.030	0.84
30_A	101_F	1.029	0.84
45_L	52_L	1.025	0.84
32_A	70_T	1.015	0.83
78_K	86_T	0.998	0.82
33_L	72_V	0.982	0.81
67_M	73_C	0.964	0.80
38_A	56_L	0.963	0.80
65_R	68_A	0.962	0.80
19_K	47_E	0.927	0.77
5_A	43_I	0.921	0.77
33_L	67_M	0.920	0.77
61_E	74_Q	0.910	0.76
32_A	36_H	0.896	0.75
44_F	57_E	0.891	0.74
30_A	103_L	0.872	0.73
36_H	70_T	0.860	0.72
58_I	62_E	0.855	0.71
4_K	61_E	0.853	0.71
46_D	51_R	0.851	0.71
34_K	59_E	0.835	0.70
7_I	53_F	0.827	0.69
56_L	64_W	0.808	0.67
4_K	56_L	0.780	0.64
20_Q	65_R	0.778	0.64
34_K	103_L	0.776	0.64
2_K	96_D	0.772	0.63
4_K	64_W	0.763	0.63
44_F	99_E	0.756	0.62
35_A	70_T	0.755	0.62
21_R	52_L	0.738	0.60
4_K	44_F	0.738	0.60
69_D	74_Q	0.737	0.60
14_K	83_L	0.731	0.59
60_D	65_R	0.730	0.59
19_K	100_V	0.727	0.59
32_A	73_C	0.719	0.58
78_K	81_A	0.716	0.58
46_D	50_G	0.712	0.57
89_D	92_P	0.703	0.56
33_L	36_H	0.699	0.56
42_S	57_E	0.694	0.55
3_R	55_Y	0.692	0.55
58_I	94_A	0.690	0.55
38_A	67_M	0.690	0.55
6_S	56_L	0.687	0.55
29_M	32_A	0.672	0.53
22_H	76_W	0.665	0.52
44_F	55_Y	0.662	0.52
62_E	66_K	0.661	0.52
79_S	83_L	0.661	0.52
71_E	95_I	0.658	0.51
7_I	95_I	0.651	0.51
65_R	69_D	0.634	0.49
58_I	63_K	0.630	0.48
25_I	29_M	0.630	0.48
3_R	44_F	0.629	0.48
80_M	83_L	0.628	0.48
4_K	58_I	0.628	0.48
74_Q	77_W	0.624	0.48
61_E	65_R	0.620	0.47
35_A	66_K	0.619	0.47
36_H	58_I	0.618	0.47
56_L	70_T	0.610	0.46
36_H	63_K	0.606	0.46
41_Y	101_F	0.602	0.45
33_L	56_L	0.602	0.45
54_A	83_L	0.595	0.45
39_H	103_L	0.593	0.44
46_D	89_D	0.592	0.44
89_D	93_V	0.591	0.44
9_F	50_G	0.582	0.43
5_A	38_A	0.582	0.43
37_G	80_M	0.578	0.43
39_H	102_Y	0.574	0.42
57_E	99_E	0.571	0.42
25_I	103_L	0.562	0.41
33_L	77_W	0.561	0.41
32_A	35_A	0.560	0.41
87_N	93_V	0.556	0.40
2_K	62_E	0.555	0.40
54_A	73_C	0.551	0.40
59_E	63_K	0.549	0.40
38_A	43_I	0.547	0.39
8_M	93_V	0.546	0.39
64_W	73_C	0.545	0.39
2_K	58_I	0.538	0.39
33_L	103_L	0.537	0.38
77_W	84_M	0.532	0.38
36_H	73_C	0.532	0.38
9_F	61_E	0.530	0.38
3_R	58_I	0.528	0.38
80_M	101_F	0.528	0.38
8_M	77_W	0.515	0.36
57_E	102_Y	0.513	0.36
15_Y	98_K	0.511	0.36
3_R	40_H	0.510	0.36
31_E	99_E	0.507	0.35
41_Y	52_L	0.505	0.35
12_Q	88_S	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qlwA	3	1	100	0.142	Contact Map
1x8dA	2	1	100	0.145	Contact Map
4dpoA	2	0.8942	96.7	0.842	Contact Map
4dn9A	3	0.9231	95.9	0.853	Contact Map
4hl9A	2	0.8942	95.8	0.855	Contact Map
1y0hA	2	0.9038	95.2	0.861	Contact Map
2gffA	2	0.9327	94.7	0.865	Contact Map
1x7vA	5	0.8942	94.4	0.866	Contact Map
3gz7A	2	0.9038	94.1	0.868	Contact Map
3e8oA	2	0.8846	93.6	0.871	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.