MRPC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MRPC - Na(+)/H(+) antiporter subunit C

UniProt:	O05260	Sequences: MEILMAVLAGIIFMAATYLLLSKSLLRVIIGTALLSHGVHLMLLTMGGLKKGAAPILSEHAKSFVDPLPQALILTAIVISFGVTSFILVMAFRAYQELKSDDMDQMRGNDQHE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	113 (104)
Sequences:	1647 (979)
Seq/√Len:	96.0

BACSU - MRPC
HALSA - Q9HRS7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_F	38_G	5.373	1.00
19_L	31_G	4.511	1.00
23_K	102_D	2.877	1.00
24_S	101_D	2.745	1.00
33_A	84_T	2.433	1.00
40_H	73_I	2.410	1.00
86_F	90_M	2.374	1.00
94_A	106_M	2.322	1.00
69_P	72_L	2.165	1.00
102_D	105_Q	2.079	1.00
36_S	76_A	2.025	1.00
100_S	105_Q	1.930	1.00
43_L	47_G	1.910	1.00
84_T	88_L	1.865	1.00
94_A	98_L	1.846	1.00
43_L	73_I	1.842	1.00
13_F	39_V	1.829	1.00
10_G	14_M	1.800	1.00
16_A	35_L	1.796	1.00
29_I	84_T	1.742	1.00
22_S	27_R	1.514	1.00
90_M	93_R	1.483	1.00
25_L	102_D	1.476	1.00
39_V	56_I	1.441	1.00
31_G	34_L	1.389	0.99
40_H	79_I	1.384	0.99
16_A	89_V	1.337	0.99
19_L	22_S	1.314	0.99
65_V	70_Q	1.294	0.99
36_S	79_I	1.286	0.99
93_R	96_Q	1.276	0.99
14_M	18_Y	1.274	0.99
13_F	35_L	1.255	0.99
71_A	79_I	1.252	0.99
11_I	65_V	1.238	0.99
29_I	91_A	1.158	0.98
26_L	91_A	1.151	0.98
40_H	47_G	1.133	0.98
20_L	32_T	1.128	0.97
15_A	34_L	1.121	0.97
66_D	84_T	1.120	0.97
32_T	41_L	1.096	0.97
20_L	33_A	1.089	0.97
66_D	70_Q	1.085	0.97
28_V	79_I	1.072	0.97
83_V	90_M	1.031	0.96
29_I	87_I	1.023	0.95
12_I	35_L	1.011	0.95
58_S	63_S	0.989	0.95
86_F	89_V	0.983	0.94
20_L	99_K	0.974	0.94
26_L	73_I	0.972	0.94
29_I	43_L	0.967	0.94
20_L	85_S	0.953	0.93
40_H	43_L	0.950	0.93
35_L	71_A	0.941	0.93
71_A	81_F	0.936	0.93
99_K	103_M	0.924	0.92
40_H	76_A	0.904	0.92
44_L	73_I	0.895	0.91
8_L	20_L	0.885	0.91
28_V	103_M	0.883	0.91
44_L	51_K	0.864	0.90
36_S	80_S	0.856	0.89
66_D	79_I	0.844	0.88
24_S	94_A	0.841	0.88
37_H	42_M	0.831	0.88
17_T	21_L	0.826	0.87
18_Y	90_M	0.818	0.87
94_A	101_D	0.811	0.86
36_S	64_F	0.798	0.85
47_G	69_P	0.794	0.85
54_A	83_V	0.791	0.85
23_K	93_R	0.781	0.84
29_I	93_R	0.776	0.84
44_L	81_F	0.757	0.82
53_A	63_S	0.754	0.82
74_L	77_I	0.740	0.81
36_S	90_M	0.737	0.81
87_I	94_A	0.735	0.80
6_A	14_M	0.733	0.80
41_L	65_V	0.732	0.80
27_R	42_M	0.731	0.80
48_G	81_F	0.728	0.80
51_K	55_P	0.724	0.79
28_V	98_L	0.713	0.78
86_F	93_R	0.708	0.78
5_M	45_T	0.705	0.78
81_F	89_V	0.697	0.77
50_K	60_H	0.696	0.77
11_I	15_A	0.688	0.76
82_G	93_R	0.678	0.75
96_Q	101_D	0.676	0.75
20_L	65_V	0.673	0.74
16_A	67_P	0.672	0.74
56_I	85_S	0.670	0.74
7_V	10_G	0.668	0.74
13_F	45_T	0.667	0.74
51_K	63_S	0.664	0.73
99_K	102_D	0.662	0.73
70_Q	79_I	0.660	0.73
5_M	8_L	0.658	0.73
53_A	62_K	0.657	0.73
48_G	52_G	0.649	0.72
29_I	61_A	0.645	0.71
19_L	30_I	0.628	0.69
27_R	88_L	0.625	0.69
80_S	89_V	0.625	0.69
13_F	26_L	0.623	0.69
36_S	85_S	0.622	0.68
23_K	30_I	0.617	0.68
10_G	47_G	0.617	0.68
7_V	102_D	0.615	0.68
68_L	84_T	0.615	0.68
61_A	83_V	0.614	0.67
21_L	95_Y	0.612	0.67
3_I	16_A	0.605	0.66
66_D	101_D	0.597	0.65
47_G	70_Q	0.595	0.65
29_I	37_H	0.595	0.65
6_A	25_L	0.592	0.65
7_V	14_M	0.591	0.65
66_D	83_V	0.589	0.64
76_A	80_S	0.588	0.64
91_A	101_D	0.586	0.64
23_K	89_V	0.585	0.64
23_K	105_Q	0.578	0.63
46_M	84_T	0.577	0.63
3_I	7_V	0.576	0.63
58_S	64_F	0.575	0.62
56_I	72_L	0.569	0.62
22_S	25_L	0.568	0.61
37_H	84_T	0.563	0.61
50_K	65_V	0.560	0.60
37_H	86_F	0.559	0.60
16_A	20_L	0.556	0.60
21_L	28_V	0.554	0.60
56_I	67_P	0.551	0.59
21_L	103_M	0.551	0.59
37_H	92_F	0.550	0.59
31_G	74_L	0.549	0.59
19_L	47_G	0.548	0.59
19_L	34_L	0.547	0.59
49_L	52_G	0.543	0.58
36_S	40_H	0.542	0.58
50_K	62_K	0.540	0.58
48_G	92_F	0.537	0.57
23_K	50_K	0.529	0.56
56_I	61_A	0.526	0.56
90_M	100_S	0.517	0.54
7_V	11_I	0.514	0.54
20_L	35_L	0.510	0.53
54_A	85_S	0.503	0.52
57_L	60_H	0.502	0.52
51_K	83_V	0.500	0.52
8_L	51_K	0.500	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rkoK	1	0.8584	99.6	0.595	Contact Map
4he8K	1	0.8319	99.5	0.611	Contact Map
3pjsK	4	0.885	29.6	0.919	Contact Map
1lnqA	6	0.6903	21.6	0.923	Contact Map
2a9hA	4	0.7699	21	0.924	Contact Map
2kluA	1	0.4248	19.4	0.925	Contact Map
3ukmA	2	0.7965	17.9	0.926	Contact Map
4bw5A	2	0.7788	17.6	0.927	Contact Map
3effK	4	0.885	16.1	0.928	Contact Map
3vouA	4	0.823	16	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.