MRPB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MRPB - Na(+)/H(+) antiporter subunit B

UniProt:	O05259	Sequences: MNEQKTNDLILQTATKLVSFIILLFSFYLFLSGHNAPGGGFVGGLITSSSIVLLLLAYDLKTVRSLLPVNFIYVAGAGLLLAVLTGVGSFVFGAPFLTHTFGYFQLPILGKTELATATIFDLGVYLVVVGITMTIIQTIGEEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (135)
Sequences:	1282 (788)
Seq/√Len:	67.8

BACSU - MRPB
HALSA - Q9HRS6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_S	125_Y	7.189	1.00
29_L	46_I	4.637	1.00
103_Y	111_K	4.392	1.00
47_T	125_Y	3.596	1.00
101_F	113_E	3.591	1.00
30_F	122_L	3.420	1.00
105_Q	111_K	2.887	1.00
103_Y	113_E	2.645	1.00
88_G	116_T	2.397	1.00
26_S	47_T	2.366	1.00
86_G	96_F	2.292	1.00
94_A	98_T	2.265	1.00
95_P	98_T	1.975	1.00
88_G	119_I	1.913	1.00
116_T	119_I	1.880	1.00
85_T	119_I	1.797	1.00
79_L	127_V	1.748	1.00
104_F	114_L	1.712	1.00
94_A	100_T	1.698	1.00
86_G	89_S	1.650	0.99
77_A	126_L	1.630	0.99
85_T	88_G	1.515	0.99
81_L	126_L	1.507	0.99
101_F	117_A	1.493	0.99
88_G	100_T	1.470	0.99
12_Q	16_K	1.400	0.98
101_F	115_A	1.363	0.98
11_L	53_L	1.328	0.97
23_L	47_T	1.316	0.97
89_S	92_F	1.313	0.97
106_L	112_T	1.303	0.97
77_A	93_G	1.298	0.97
27_F	31_L	1.286	0.97
80_L	84_L	1.274	0.96
59_D	62_T	1.254	0.96
53_L	67_L	1.252	0.96
27_F	30_F	1.250	0.96
31_L	66_L	1.223	0.95
83_V	87_V	1.216	0.95
7_N	12_Q	1.193	0.95
70_N	73_Y	1.189	0.95
12_Q	58_Y	1.156	0.94
14_A	80_L	1.118	0.93
28_Y	31_L	1.099	0.92
35_N	113_E	1.083	0.92
87_V	91_V	1.081	0.91
87_V	90_F	1.080	0.91
71_F	138_T	1.058	0.91
105_Q	112_T	1.058	0.91
35_N	42_V	1.055	0.90
28_Y	45_L	1.048	0.90
118_T	122_L	1.039	0.90
51_I	68_P	1.026	0.89
10_I	13_T	1.010	0.88
80_L	87_V	1.010	0.88
34_H	39_G	1.008	0.88
101_F	119_I	1.000	0.88
99_H	117_A	0.998	0.88
88_G	92_F	0.997	0.88
86_G	97_L	0.996	0.88
63_V	68_P	0.988	0.87
19_S	54_L	0.981	0.87
26_S	43_G	0.979	0.87
89_S	94_A	0.972	0.86
135_I	139_I	0.961	0.86
99_H	115_A	0.955	0.85
43_G	49_S	0.951	0.85
55_L	137_Q	0.944	0.85
11_L	74_V	0.943	0.85
81_L	84_L	0.942	0.85
20_F	66_L	0.935	0.84
75_A	79_L	0.933	0.84
79_L	118_T	0.928	0.84
19_S	22_I	0.926	0.84
121_D	125_Y	0.922	0.83
52_V	132_T	0.920	0.83
26_S	60_L	0.919	0.83
99_H	139_I	0.916	0.83
82_A	124_V	0.914	0.83
44_G	127_V	0.902	0.82
19_S	108_I	0.882	0.81
44_G	79_L	0.881	0.80
64_R	141_E	0.877	0.80
95_P	117_A	0.873	0.80
71_F	127_V	0.860	0.79
106_L	109_L	0.845	0.78
37_P	42_V	0.825	0.76
89_S	96_F	0.805	0.74
16_K	58_Y	0.804	0.74
23_L	27_F	0.803	0.74
15_T	57_A	0.802	0.74
18_V	61_K	0.799	0.74
56_L	59_D	0.790	0.73
69_V	74_V	0.787	0.72
37_P	128_V	0.774	0.71
36_A	52_V	0.768	0.71
20_F	116_T	0.765	0.70
26_S	140_G	0.763	0.70
11_L	45_L	0.762	0.70
24_L	131_I	0.760	0.70
22_I	50_S	0.757	0.70
43_G	47_T	0.751	0.69
15_T	53_L	0.749	0.69
104_F	113_E	0.749	0.69
22_I	53_L	0.747	0.68
84_L	89_S	0.742	0.68
88_G	133_M	0.741	0.68
48_S	132_T	0.739	0.68
50_S	58_Y	0.736	0.67
28_Y	46_I	0.734	0.67
117_A	133_M	0.732	0.67
12_Q	57_A	0.730	0.67
9_L	15_T	0.725	0.66
118_T	129_V	0.722	0.66
109_L	112_T	0.720	0.66
9_L	13_T	0.711	0.65
30_F	126_L	0.710	0.65
137_Q	140_G	0.709	0.64
77_A	84_L	0.703	0.64
105_Q	113_E	0.700	0.63
48_S	134_T	0.700	0.63
120_F	128_V	0.695	0.63
69_V	73_Y	0.693	0.63
19_S	42_V	0.693	0.63
125_Y	140_G	0.692	0.63
59_D	141_E	0.689	0.62
47_T	50_S	0.688	0.62
56_L	72_I	0.687	0.62
86_G	115_A	0.685	0.62
60_L	137_Q	0.685	0.62
26_S	121_D	0.681	0.61
114_L	118_T	0.680	0.61
50_S	138_T	0.665	0.60
9_L	18_V	0.664	0.59
115_A	118_T	0.658	0.59
84_L	88_G	0.655	0.58
52_V	139_I	0.653	0.58
90_F	93_G	0.651	0.58
18_V	53_L	0.645	0.57
76_G	124_V	0.645	0.57
73_Y	77_A	0.643	0.57
9_L	67_L	0.641	0.57
28_Y	32_S	0.638	0.56
11_L	57_A	0.637	0.56
82_A	92_F	0.635	0.56
89_S	98_T	0.630	0.55
64_R	137_Q	0.623	0.55
14_A	45_L	0.617	0.54
21_I	96_F	0.615	0.54
82_A	86_G	0.610	0.53
22_I	51_I	0.604	0.52
77_A	91_V	0.601	0.52
62_T	141_E	0.599	0.52
64_R	74_V	0.597	0.52
18_V	31_L	0.594	0.51
74_V	126_L	0.592	0.51
100_T	115_A	0.592	0.51
43_G	74_V	0.591	0.51
116_T	130_G	0.587	0.50
124_V	130_G	0.586	0.50
102_G	113_E	0.583	0.50
35_N	131_I	0.582	0.50
26_S	46_I	0.581	0.50
32_S	45_L	0.579	0.49
55_L	99_H	0.566	0.48
89_S	95_P	0.565	0.48
107_P	110_G	0.563	0.47
27_F	71_F	0.559	0.47
80_L	83_V	0.558	0.47
131_I	135_I	0.556	0.47
10_I	61_K	0.556	0.47
48_S	68_P	0.554	0.46
80_L	102_G	0.554	0.46
117_A	121_D	0.553	0.46
28_Y	87_V	0.552	0.46
21_I	120_F	0.548	0.46
90_F	112_T	0.546	0.45
23_L	73_Y	0.542	0.45
121_D	127_V	0.539	0.45
25_F	36_A	0.539	0.45
73_Y	83_V	0.537	0.44
80_L	136_I	0.537	0.44
61_K	65_S	0.536	0.44
9_L	20_F	0.532	0.44
94_A	116_T	0.525	0.43
105_Q	109_L	0.525	0.43
85_T	101_F	0.524	0.43
75_A	134_T	0.521	0.42
18_V	52_V	0.520	0.42
69_V	106_L	0.518	0.42
137_Q	141_E	0.518	0.42
124_V	134_T	0.517	0.42
22_I	137_Q	0.516	0.42
90_F	110_G	0.515	0.42
67_L	95_P	0.512	0.41
81_L	122_L	0.509	0.41
8_D	20_F	0.509	0.41
113_E	117_A	0.508	0.41
29_L	97_L	0.501	0.40
65_S	91_V	0.501	0.40
127_V	137_Q	0.500	0.40
15_T	92_F	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1q16C	2	0.7622	5.9	0.952	Contact Map
4ev6A	3	0.4266	5.8	0.952	Contact Map
3iyzA	3	0.8392	4.1	0.956	Contact Map
4i0uA	4	0.3986	3.7	0.956	Contact Map
2zz9A	3	0.8392	3.6	0.957	Contact Map
1yfsA	1	0.2238	3.1	0.958	Contact Map
2ks1B	1	0.2308	2.9	0.959	Contact Map
4cadC	1	0.7972	2.6	0.96	Contact Map
2f2bA	4	0.7762	2.1	0.962	Contact Map
4nefA	4	0.9021	2.1	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.