YUGN - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUGN - Uncharacterized protein YugN

UniProt:	O05246	Sequences: MIPIPSAIDGQSFLLQELEQVMKPLGYVINGGWEYDHGYFDYKIDDRDGYLFLRIPVNAVQGSLDERGAAVRIGTPFMLRQVFQADVDDHAEGGPFQSLFNQFSEPERRDAEIDPAFLDIGASLVKELEDVLLH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	134 (131)
Sequences:	162 (136)
Seq/√Len:	11.8

BACSU - YUGN

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_I	73_I	3.406	0.98
95_P	98_S	3.286	0.97
8_I	126_K	2.887	0.94
3_P	101_N	2.397	0.86
104_S	109_R	2.355	0.85
82_V	111_A	2.273	0.83
43_K	52_F	2.218	0.82
80_R	114_D	2.211	0.81
48_D	82_V	2.125	0.79
19_E	23_K	2.108	0.78
79_L	83_F	2.108	0.78
82_V	108_R	2.097	0.78
97_Q	101_N	2.058	0.76
36_D	61_Q	2.017	0.75
43_K	50_Y	1.959	0.72
66_E	69_A	1.953	0.72
9_D	75_T	1.953	0.72
18_L	71_V	1.948	0.72
17_E	28_V	1.883	0.69
27_Y	128_L	1.769	0.64
15_L	40_F	1.721	0.62
82_V	86_D	1.664	0.59
58_N	72_R	1.624	0.57
39_Y	77_F	1.610	0.57
114_D	121_G	1.591	0.56
89_D	105_E	1.515	0.52
82_V	107_E	1.513	0.52
125_V	128_L	1.513	0.52
57_V	71_V	1.464	0.50
15_L	29_I	1.403	0.46
8_I	108_R	1.400	0.46
37_H	74_G	1.396	0.46
34_E	38_G	1.389	0.46
100_F	121_G	1.343	0.44
87_V	95_P	1.334	0.43
86_D	108_R	1.312	0.42
15_L	71_V	1.299	0.41
7_A	100_F	1.297	0.41
12_S	72_R	1.290	0.41
44_I	124_L	1.289	0.41
10_G	128_L	1.289	0.41
15_L	24_P	1.289	0.41
45_D	53_L	1.253	0.39
27_Y	125_V	1.246	0.39
19_E	42_Y	1.245	0.39
86_D	112_E	1.200	0.37
14_L	39_Y	1.195	0.36
111_A	116_A	1.162	0.35
115_P	118_L	1.160	0.35
51_L	80_R	1.134	0.34
47_R	116_A	1.114	0.33
18_L	36_D	1.107	0.32
4_I	125_V	1.094	0.32
90_H	120_I	1.090	0.32
19_E	50_Y	1.088	0.32
53_L	125_V	1.087	0.32
80_R	113_I	1.079	0.31
58_N	74_G	1.061	0.31
50_Y	85_A	1.057	0.30
15_L	68_G	1.053	0.30
5_P	96_F	1.050	0.30
108_R	116_A	1.044	0.30
84_Q	89_D	1.037	0.30
8_I	69_A	1.032	0.29
59_A	84_Q	1.024	0.29
74_G	104_S	1.020	0.29
40_F	65_D	1.016	0.29
47_R	108_R	1.008	0.28
10_G	75_T	0.987	0.27
47_R	126_K	0.985	0.27
19_E	127_E	0.982	0.27
78_M	120_I	0.978	0.27
3_P	121_G	0.974	0.27
16_Q	52_F	0.969	0.27
25_L	127_E	0.960	0.26
109_R	123_S	0.955	0.26
23_K	128_L	0.954	0.26
91_A	97_Q	0.945	0.26
67_R	73_I	0.945	0.26
27_Y	33_W	0.941	0.26
7_A	72_R	0.922	0.25
14_L	69_A	0.922	0.25
58_N	77_F	0.919	0.25
94_G	101_N	0.911	0.25
51_L	121_G	0.903	0.24
23_K	87_V	0.901	0.24
49_G	105_E	0.897	0.24
103_F	106_P	0.895	0.24
15_L	69_A	0.894	0.24
13_F	32_G	0.889	0.24
101_N	118_L	0.874	0.23
75_T	98_S	0.860	0.23
12_S	126_K	0.847	0.22
59_A	104_S	0.840	0.22
10_G	72_R	0.832	0.22
82_V	112_E	0.827	0.22
20_Q	63_S	0.826	0.22
27_Y	31_G	0.816	0.21
33_W	111_A	0.816	0.21
52_F	91_A	0.813	0.21
63_S	70_A	0.811	0.21
67_R	93_G	0.806	0.21
4_I	84_Q	0.804	0.21
12_S	91_A	0.804	0.21
19_E	87_V	0.797	0.21
83_F	129_E	0.795	0.21
48_D	85_A	0.784	0.20
80_R	107_E	0.777	0.20
66_E	98_S	0.773	0.20
91_A	101_N	0.769	0.20
66_E	101_N	0.768	0.20
10_G	122_A	0.766	0.20
108_R	112_E	0.761	0.19
27_Y	77_F	0.761	0.19
121_G	131_V	0.755	0.19
92_E	97_Q	0.742	0.19
22_M	33_W	0.742	0.19
74_G	77_F	0.740	0.19
63_S	122_A	0.740	0.19
59_A	117_F	0.739	0.19
8_I	21_V	0.737	0.19
117_F	131_V	0.730	0.18
68_G	100_F	0.724	0.18
6_S	118_L	0.718	0.18
42_Y	50_Y	0.717	0.18
7_A	28_V	0.716	0.18
60_V	72_R	0.715	0.18
7_A	118_L	0.713	0.18
6_S	129_E	0.711	0.18
90_H	97_Q	0.707	0.18
15_L	59_A	0.705	0.18
8_I	107_E	0.697	0.18
25_L	131_V	0.694	0.17
11_Q	58_N	0.689	0.17
29_I	59_A	0.687	0.17
101_N	117_F	0.684	0.17
26_G	124_L	0.683	0.17
86_D	107_E	0.681	0.17
30_N	39_Y	0.679	0.17
86_D	115_P	0.678	0.17
73_I	123_S	0.667	0.17
52_F	117_F	0.664	0.17
4_I	51_L	0.642	0.16
18_L	29_I	0.641	0.16
32_G	123_S	0.641	0.16
51_L	86_D	0.639	0.16
5_P	124_L	0.637	0.16
8_I	131_V	0.637	0.16
24_P	60_V	0.634	0.16
106_P	110_D	0.632	0.16
103_F	110_D	0.632	0.16
22_M	55_I	0.631	0.16
84_Q	87_V	0.621	0.15
31_G	53_L	0.619	0.15
69_A	80_R	0.613	0.15
42_Y	129_E	0.605	0.15
13_F	50_Y	0.605	0.15
29_I	85_A	0.604	0.15
78_M	114_D	0.598	0.15
69_A	122_A	0.595	0.15
65_D	101_N	0.595	0.15
43_K	79_L	0.592	0.15
2_I	108_R	0.591	0.15
78_M	111_A	0.590	0.15
30_N	116_A	0.589	0.15
29_I	33_W	0.583	0.14
16_Q	63_S	0.583	0.14
28_V	60_V	0.579	0.14
9_D	109_R	0.575	0.14
104_S	131_V	0.572	0.14
55_I	128_L	0.569	0.14
50_Y	78_M	0.559	0.14
42_Y	51_L	0.559	0.14
115_P	119_D	0.558	0.14
47_R	98_S	0.556	0.14
71_V	77_F	0.550	0.14
4_I	101_N	0.549	0.14
14_L	25_L	0.546	0.14
23_K	36_D	0.544	0.14
69_A	107_E	0.544	0.14
16_Q	121_G	0.544	0.14
27_Y	61_Q	0.536	0.13
30_N	99_L	0.535	0.13
78_M	121_G	0.534	0.13
28_V	109_R	0.531	0.13
46_D	104_S	0.529	0.13
55_I	69_A	0.528	0.13
1_M	26_G	0.528	0.13
71_V	88_D	0.528	0.13
27_Y	120_I	0.521	0.13
39_Y	69_A	0.517	0.13
89_D	98_S	0.517	0.13
17_E	72_R	0.510	0.13
93_G	99_L	0.504	0.13
46_D	95_P	0.503	0.13
4_I	12_S	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2r5xA	1	0.8433	100	0.353	Contact Map
2pwwA	1	0.8507	100	0.365	Contact Map
1hp1A	1	0.8806	51.6	0.938	Contact Map
3iveA	1	0.8731	31.7	0.945	Contact Map
3c9fA	2	0.8881	26.6	0.947	Contact Map
2z1aA	1	0.8657	25.5	0.948	Contact Map
3gveA	2	0.9328	24	0.948	Contact Map
3jyfA	2	0.9403	23.9	0.948	Contact Map
4b2oA	4	0.7985	21.2	0.949	Contact Map
4hppA	3	0.9701	18.2	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.