MRPF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MRPF - Na(+)/H(+) antiporter subunit F

UniProt:	O05228	Sequences: MFTLILQIALGIMAVSTFLYVIRVIKGPTVPDRVVALDAIGINLIAITALVSILLKTSAFLDIILLLGILSFIGTIAFSKFLEKGEIIENDRNR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	94 (88)
Sequences:	828 (543)
Seq/√Len:	57.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_I	12_I	4.772	1.00
17_T	40_I	3.396	1.00
4_L	8_I	2.633	1.00
13_M	50_L	2.568	1.00
22_I	26_K	2.180	1.00
8_I	11_G	1.952	1.00
16_S	84_K	1.940	1.00
24_V	36_A	1.897	1.00
50_L	53_I	1.894	1.00
15_V	19_L	1.880	1.00
52_S	61_L	1.870	1.00
41_G	67_L	1.816	0.99
3_T	26_K	1.794	0.99
5_I	9_A	1.790	0.99
80_K	86_E	1.753	0.99
84_K	89_E	1.659	0.99
20_Y	40_I	1.619	0.99
67_L	70_L	1.613	0.99
51_V	55_L	1.512	0.98
20_Y	66_L	1.456	0.97
36_A	40_I	1.447	0.97
9_A	50_L	1.444	0.97
65_L	70_L	1.425	0.97
20_Y	43_N	1.324	0.95
4_L	7_Q	1.323	0.95
41_G	70_L	1.302	0.95
38_D	77_A	1.283	0.95
18_F	21_V	1.275	0.94
52_S	71_S	1.261	0.94
37_L	74_G	1.238	0.93
67_L	88_I	1.205	0.93
3_T	7_Q	1.198	0.92
10_L	54_L	1.179	0.92
41_G	44_L	1.165	0.91
39_A	43_N	1.141	0.90
65_L	80_K	1.140	0.90
10_L	47_I	1.123	0.90
49_A	68_G	1.094	0.88
2_F	59_A	1.082	0.88
46_A	86_E	1.076	0.87
2_F	6_L	1.062	0.87
43_N	46_A	1.052	0.86
40_I	69_I	1.041	0.86
24_V	27_G	1.016	0.84
34_V	78_F	1.013	0.84
62_D	80_K	1.013	0.84
37_L	79_S	1.011	0.84
38_D	75_T	1.008	0.84
29_T	66_L	1.005	0.84
65_L	85_G	0.998	0.83
46_A	51_V	0.979	0.82
2_F	5_I	0.975	0.82
4_L	9_A	0.954	0.80
26_K	40_I	0.953	0.80
45_I	80_K	0.933	0.79
60_F	83_E	0.929	0.79
18_F	68_G	0.915	0.77
23_R	28_P	0.900	0.76
50_L	87_I	0.887	0.75
19_L	69_I	0.875	0.74
43_N	83_E	0.866	0.73
23_R	27_G	0.861	0.73
47_I	54_L	0.860	0.73
72_F	75_T	0.856	0.73
45_I	71_S	0.835	0.71
7_Q	14_A	0.831	0.70
34_V	82_L	0.829	0.70
46_A	81_F	0.815	0.69
61_L	89_E	0.805	0.68
79_S	88_I	0.803	0.68
34_V	61_L	0.801	0.68
38_D	70_L	0.793	0.67
16_S	31_P	0.750	0.62
3_T	14_A	0.748	0.62
31_P	81_F	0.744	0.62
45_I	67_L	0.721	0.59
6_L	50_L	0.712	0.58
19_L	25_I	0.712	0.58
9_A	54_L	0.705	0.58
21_V	66_L	0.705	0.58
53_I	77_A	0.677	0.55
35_V	61_L	0.676	0.54
34_V	37_L	0.675	0.54
74_G	80_K	0.669	0.54
7_Q	54_L	0.661	0.53
44_L	54_L	0.655	0.52
54_L	87_I	0.648	0.51
16_S	19_L	0.647	0.51
19_L	50_L	0.643	0.51
59_A	71_S	0.642	0.51
39_A	42_I	0.641	0.51
48_T	63_I	0.636	0.50
13_M	70_L	0.633	0.50
53_I	56_K	0.627	0.49
47_I	88_I	0.621	0.48
66_L	80_K	0.617	0.48
20_Y	39_A	0.616	0.48
71_S	74_G	0.611	0.47
10_L	25_I	0.588	0.45
50_L	69_I	0.585	0.44
82_L	86_E	0.584	0.44
29_T	49_A	0.582	0.44
31_P	80_K	0.581	0.44
30_V	87_I	0.577	0.44
18_F	56_K	0.576	0.43
70_L	75_T	0.573	0.43
17_T	24_V	0.565	0.42
12_I	69_I	0.563	0.42
10_L	29_T	0.559	0.42
15_V	21_V	0.557	0.41
73_I	88_I	0.556	0.41
42_I	50_L	0.553	0.41
74_G	82_L	0.551	0.41
13_M	16_S	0.550	0.41
54_L	58_S	0.539	0.40
14_A	18_F	0.538	0.39
14_A	87_I	0.534	0.39
5_I	24_V	0.531	0.39
30_V	56_K	0.524	0.38
49_A	76_I	0.524	0.38
61_L	64_I	0.520	0.38
24_V	81_F	0.519	0.37
35_V	52_S	0.518	0.37
70_L	74_G	0.515	0.37
35_V	75_T	0.514	0.37
19_L	22_I	0.511	0.37
39_A	69_I	0.510	0.37
11_G	31_P	0.509	0.36
41_G	83_E	0.506	0.36
34_V	86_E	0.502	0.36
9_A	43_N	0.500	0.35
7_Q	15_V	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j08A	2	0.9468	16.2	0.919	Contact Map
4bbjA	1	0.9362	15.7	0.92	Contact Map
3j09A	2	0.9468	13.8	0.922	Contact Map
1oqwA	1	0.3936	13.4	0.922	Contact Map
2hi2A	1	0.383	10	0.927	Contact Map
3sokA	1	0.3936	8.2	0.929	Contact Map
1n2sA	2	0.3511	6.9	0.932	Contact Map
3st7A	2	0.3511	6.6	0.933	Contact Map
3iusA	1	0.3511	5.9	0.934	Contact Map
3eheA	2	0.3404	5.7	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.