YJHB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJHB - Putative ADP-ribose pyrophosphatase YjhB

UniProt:	C0SPC3	Sequences: MIKVQTKWLERAQRIRAIAQAGLAFSKDVYDRERYEELMKLSAEMMADYSEKDIEVITDLWQGEKGYPTPKADVRGAVFRENQILLVREKHDELWSLPGGFCEIGLSPAENVVKEIKEESGYDTEPSRLLAVLDSHKHSHPPQPYHYYKIFIACSMTDGQGETGIETNHAAFFPEDRLPPLSPKRNTPSQLSMLFDFLRHPDKKTIFD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (169)
Sequences:	2672 (1822)
Seq/√Len:	140.1

ECOLI - NUDC
BACSU - YJHB MUTT
SULSO - Q97WE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
117_K	123_D	5.039	1.00
80_R	83_Q	3.883	1.00
95_W	169_H	3.495	1.00
108_P	150_I	3.137	1.00
126_P	155_S	2.876	1.00
77_A	84_I	2.799	1.00
125_E	155_S	2.764	1.00
83_Q	174_P	2.695	1.00
108_P	152_I	2.622	1.00
88_R	169_H	2.499	1.00
123_D	157_T	2.436	1.00
188_P	192_S	2.409	1.00
88_R	168_N	2.380	1.00
78_V	116_I	2.366	1.00
125_E	157_T	2.365	1.00
42_S	45_M	2.317	1.00
47_A	60_L	2.237	1.00
174_P	177_R	2.213	1.00
110_E	113_V	2.077	1.00
122_Y	156_M	2.006	1.00
106_L	114_K	1.944	1.00
82_N	175_E	1.899	1.00
87_V	98_P	1.876	1.00
50_S	60_L	1.859	1.00
42_S	59_D	1.846	1.00
19_A	22_G	1.790	1.00
113_V	127_S	1.768	1.00
86_L	173_F	1.762	1.00
102_C	108_P	1.737	1.00
59_D	62_Q	1.710	1.00
113_V	125_E	1.696	1.00
116_I	124_T	1.688	1.00
82_N	174_P	1.682	1.00
45_M	59_D	1.656	1.00
45_M	62_Q	1.651	1.00
90_K	168_N	1.635	1.00
76_G	116_I	1.609	1.00
38_L	44_E	1.499	1.00
89_E	96_S	1.477	1.00
123_D	158_D	1.475	1.00
120_S	170_A	1.422	1.00
47_A	61_W	1.413	1.00
161_G	170_A	1.383	1.00
189_S	193_M	1.355	1.00
102_C	111_N	1.355	1.00
42_S	62_Q	1.325	1.00
98_P	120_S	1.318	1.00
78_V	154_C	1.317	1.00
79_F	155_S	1.314	1.00
76_G	154_C	1.296	1.00
76_G	112_V	1.295	1.00
80_R	159_G	1.294	1.00
89_E	92_D	1.289	1.00
133_L	193_M	1.280	1.00
128_R	153_A	1.277	1.00
129_L	132_V	1.261	1.00
82_N	176_D	1.243	1.00
111_N	114_K	1.229	1.00
76_G	98_P	1.219	1.00
132_V	150_I	1.197	1.00
73_D	149_K	1.185	1.00
171_A	177_R	1.184	1.00
130_L	153_A	1.184	1.00
108_P	148_Y	1.183	1.00
156_M	159_G	1.181	1.00
79_F	153_A	1.175	1.00
113_V	126_P	1.156	0.99
39_M	43_A	1.155	0.99
74_V	111_N	1.154	0.99
173_F	179_P	1.131	0.99
83_Q	177_R	1.104	0.99
36_E	57_I	1.103	0.99
189_S	192_S	1.071	0.99
34_R	38_L	1.065	0.99
26_S	35_Y	1.064	0.99
30_Y	34_R	1.047	0.99
120_S	167_T	1.045	0.99
127_S	155_S	1.044	0.99
70_P	104_I	1.044	0.99
124_T	154_C	1.037	0.99
97_L	151_F	1.007	0.98
85_L	122_Y	0.999	0.98
26_S	32_R	0.996	0.98
84_I	97_L	0.987	0.98
113_V	124_T	0.982	0.98
40_K	48_D	0.976	0.98
183_P	188_P	0.975	0.98
45_M	49_Y	0.964	0.98
108_P	129_L	0.949	0.98
113_V	117_K	0.920	0.97
92_D	96_S	0.918	0.97
39_M	66_G	0.915	0.97
129_L	150_I	0.914	0.97
75_R	112_V	0.909	0.97
49_Y	57_I	0.902	0.97
102_C	148_Y	0.896	0.97
106_L	111_N	0.889	0.97
52_K	58_T	0.886	0.97
43_A	62_Q	0.875	0.96
128_R	155_S	0.870	0.96
106_L	110_E	0.867	0.96
87_V	167_T	0.865	0.96
164_G	167_T	0.861	0.96
24_A	110_E	0.851	0.96
24_A	27_K	0.847	0.96
112_V	116_I	0.847	0.96
187_T	191_L	0.836	0.95
156_M	172_F	0.821	0.95
135_S	149_K	0.817	0.95
112_V	124_T	0.816	0.95
73_D	152_I	0.812	0.95
95_W	173_F	0.810	0.94
28_D	56_V	0.804	0.94
46_M	49_Y	0.792	0.94
89_E	168_N	0.790	0.94
89_E	167_T	0.788	0.94
187_T	190_Q	0.787	0.94
185_R	190_Q	0.776	0.93
122_Y	161_G	0.776	0.93
31_D	139_S	0.775	0.93
20_Q	24_A	0.774	0.93
76_G	124_T	0.771	0.93
21_A	26_S	0.759	0.92
27_K	31_D	0.750	0.92
43_A	49_Y	0.749	0.92
158_D	161_G	0.743	0.91
73_D	140_H	0.741	0.91
32_R	36_E	0.738	0.91
121_G	162_E	0.736	0.91
185_R	191_L	0.734	0.91
74_V	102_C	0.733	0.91
98_P	167_T	0.732	0.91
163_T	166_E	0.729	0.91
41_L	48_D	0.727	0.91
78_V	97_L	0.727	0.91
49_Y	66_G	0.725	0.90
77_A	97_L	0.725	0.90
21_A	24_A	0.723	0.90
159_G	179_P	0.722	0.90
48_D	60_L	0.715	0.90
120_S	164_G	0.715	0.90
71_K	139_S	0.706	0.89
74_V	112_V	0.705	0.89
53_D	65_K	0.703	0.89
18_I	22_G	0.695	0.89
101_F	135_S	0.692	0.88
113_V	123_D	0.688	0.88
93_E	168_N	0.679	0.87
99_G	149_K	0.677	0.87
182_S	185_R	0.676	0.87
34_R	37_E	0.674	0.87
68_P	133_L	0.669	0.87
161_G	164_G	0.666	0.86
126_P	152_I	0.665	0.86
87_V	120_S	0.663	0.86
36_E	51_E	0.658	0.86
96_S	186_N	0.656	0.85
76_G	79_F	0.654	0.85
95_W	98_P	0.653	0.85
108_P	134_D	0.647	0.85
21_A	25_F	0.646	0.85
28_D	34_R	0.646	0.85
167_T	170_A	0.644	0.84
109_A	129_L	0.641	0.84
35_Y	38_L	0.641	0.84
186_N	190_Q	0.639	0.84
186_N	191_L	0.639	0.84
78_V	122_Y	0.637	0.84
135_S	151_F	0.635	0.84
18_I	37_E	0.632	0.83
101_F	138_H	0.629	0.83
75_R	187_T	0.621	0.82
133_L	151_F	0.620	0.82
44_E	64_E	0.620	0.82
72_A	102_C	0.619	0.82
31_D	34_R	0.617	0.82
66_G	71_K	0.615	0.82
87_V	170_A	0.615	0.82
88_R	93_E	0.614	0.82
71_K	104_I	0.613	0.81
41_L	46_M	0.611	0.81
126_P	154_C	0.605	0.81
66_G	69_T	0.604	0.80
94_L	184_K	0.602	0.80
74_V	108_P	0.601	0.80
104_I	139_S	0.600	0.80
75_R	151_F	0.595	0.79
39_M	49_Y	0.593	0.79
53_D	56_V	0.593	0.79
88_R	92_D	0.592	0.79
182_S	187_T	0.589	0.79
69_T	75_R	0.587	0.79
32_R	35_Y	0.586	0.78
104_I	134_D	0.584	0.78
95_W	171_A	0.584	0.78
109_A	132_V	0.578	0.78
56_V	65_K	0.577	0.77
37_E	44_E	0.576	0.77
109_A	133_L	0.574	0.77
42_S	106_L	0.572	0.77
43_A	66_G	0.571	0.77
33_E	36_E	0.571	0.77
122_Y	170_A	0.571	0.77
190_Q	193_M	0.570	0.77
67_Y	101_F	0.569	0.76
106_L	109_A	0.567	0.76
97_L	173_F	0.566	0.76
115_E	119_E	0.564	0.76
79_F	84_I	0.563	0.76
73_D	102_C	0.562	0.76
105_G	135_S	0.560	0.75
20_Q	23_L	0.557	0.75
37_E	61_W	0.556	0.75
27_K	110_E	0.556	0.75
133_L	149_K	0.556	0.75
164_G	168_N	0.554	0.75
43_A	57_I	0.553	0.74
75_R	149_K	0.549	0.74
28_D	32_R	0.547	0.74
135_S	140_H	0.545	0.73
120_S	166_E	0.542	0.73
80_R	155_S	0.542	0.73
187_T	192_S	0.542	0.73
86_L	178_L	0.540	0.73
21_A	68_P	0.540	0.73
99_G	103_E	0.538	0.72
23_L	27_K	0.536	0.72
52_K	56_V	0.535	0.72
87_V	96_S	0.534	0.72
138_H	149_K	0.532	0.72
178_L	182_S	0.530	0.71
108_P	132_V	0.530	0.71
178_L	181_L	0.529	0.71
131_A	193_M	0.527	0.71
64_E	104_I	0.526	0.71
41_L	45_M	0.524	0.70
52_K	59_D	0.524	0.70
30_Y	37_E	0.523	0.70
72_A	148_Y	0.522	0.70
129_L	152_I	0.520	0.70
182_S	189_S	0.516	0.69
77_A	151_F	0.515	0.69
27_K	30_Y	0.515	0.69
50_S	53_D	0.514	0.69
39_M	139_S	0.514	0.69
112_V	154_C	0.512	0.69
48_D	58_T	0.511	0.69
182_S	186_N	0.511	0.69
176_D	179_P	0.511	0.69
74_V	77_A	0.509	0.68
106_L	133_L	0.503	0.67
33_E	37_E	0.502	0.67
21_A	82_N	0.501	0.67
99_G	151_F	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hfqA	2	0.976	100	0.366	Contact Map
3q1pA	2	0.9663	100	0.372	Contact Map
1vk6A	2	0.9327	100	0.395	Contact Map
3o8sA	2	0.6442	100	0.396	Contact Map
3cngA	4	0.7837	100	0.463	Contact Map
2qjtB	2	0.9231	100	0.511	Contact Map
3gz5A	2	0.6538	99.9	0.538	Contact Map
2qjoA	3	0.9183	99.9	0.547	Contact Map
2fmlA	2	0.8221	99.9	0.555	Contact Map
4ktbA	4	0.6538	99.9	0.568	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.